Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9314
Gene name Gene Name - the full gene name approved by the HGNC.	KLF transcription factor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KLF4
Synonyms (NCBI Gene) Gene synonyms aliases	EZF, GKLF
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q31.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition o

Show/Hide all(390)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003605	hsa-miR-25-3p	Western blot	19541842
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assay, Western blot	20075075
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assay, Western blot	20075075
MIRT005674	hsa-miR-130a-3p	Luciferase reporter assay, Microarray, qRT-PCR	20981674
MIRT005440	hsa-miR-135b-5p	Luciferase reporter assay, Microarray, qRT-PCR	20981674
MIRT000308	hsa-miR-145-5p	FACS, Flow, GFP reporter assay, In situ hybridization, Luciferase reporter assay, qRT-PCR	19409607
MIRT000308	hsa-miR-145-5p	FACS, Flow, GFP reporter assay, In situ hybridization, Luciferase reporter assay, qRT-PCR	19409607
MIRT006086	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT006086	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT006086	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT006688	hsa-miR-103a-3p	Luciferase reporter assay, Western blot	22593189
MIRT006688	hsa-miR-103a-3p	Luciferase reporter assay, Western blot	22593189
MIRT006688	hsa-miR-103a-3p	Luciferase reporter assay, Western blot	22593189
MIRT006688	hsa-miR-103a-3p	Luciferase reporter assay, Western blot	22593189
MIRT006692	hsa-miR-107	Luciferase reporter assay, Western blot	22593189
MIRT006692	hsa-miR-107	Luciferase reporter assay, Western blot	22593189
MIRT006692	hsa-miR-107	Luciferase reporter assay, Western blot	22593189
MIRT006692	hsa-miR-107	Luciferase reporter assay, Western blot	22593189
MIRT016880	hsa-miR-335-5p	Microarray	18185580
MIRT000308	hsa-miR-145-5p	Reporter assay;Western blot;qRT-PCR	19409607
MIRT021926	hsa-miR-128-3p	Reporter assay	19409607
MIRT022234	hsa-miR-124-3p	Microarray	18668037
MIRT046110	hsa-miR-30b-5p	CLASH	23622248
MIRT052916	hsa-miR-29a-3p	Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	24281002
MIRT053079	hsa-miR-15a-5p	Western blot	23867820
MIRT053079	hsa-miR-15a-5p	Western blot	23867820
MIRT052916	hsa-miR-29a-3p	Immunofluorescence, qRT-PCR, Reporter assay	22751119
MIRT053423	hsa-miR-624-3p	Microarray	23807165
MIRT021926	hsa-miR-128-3p	Flow, qRT-PCR, Western blot	23019226
MIRT054372	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24415058
MIRT003216	hsa-miR-10b-5p	Flow, qRT-PCR, Western blot	24216130
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assay, qRT-PCR, Western blot	24573354
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assay, qRT-PCR, Western blot	24573354
MIRT054913	hsa-miR-7-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	23384942
MIRT054913	hsa-miR-7-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	23384942
MIRT054913	hsa-miR-7-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	23384942
MIRT000308	hsa-miR-145-5p	qRT-PCR	23312222
MIRT438357	hsa-miR-206	Flow, qRT-PCR	24855559
MIRT000308	hsa-miR-145-5p	qRT-PCR, Western blot	25273883
MIRT438305	hsa-miR-152-3p	Immunoprecipitaion, qRT-PCR, Western blot, Luciferase reporter assay	25218589
MIRT438305	hsa-miR-152-3p	Immunoprecipitaion, qRT-PCR, Western blot, Luciferase reporter assay	25218589
MIRT438288	hsa-miR-137	Luciferase reporter assay	24084696
MIRT438288	hsa-miR-137	Luciferase reporter assay	24084696
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	24200387
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	24200387
MIRT000308	hsa-miR-145-5p	qRT-PCR	23312222
MIRT438357	hsa-miR-206	Flow, qRT-PCR	24855559
MIRT000308	hsa-miR-145-5p	qRT-PCR, Western blot	25273883
MIRT438305	hsa-miR-152-3p	Immunoprecipitaion, qRT-PCR, Western blot, Luciferase reporter assay	25218589
MIRT438305	hsa-miR-152-3p	Immunoprecipitaion, qRT-PCR, Western blot, Luciferase reporter assay	25218589
MIRT438288	hsa-miR-137	Luciferase reporter assay	24084696
MIRT438288	hsa-miR-137	Luciferase reporter assay	24084696
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	24200387
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	24200387
MIRT003605	hsa-miR-25-3p	Luciferase reporter assay	25923408
MIRT003605	hsa-miR-25-3p	Luciferase reporter assay	25923408
MIRT000308	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	28380435
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26191201
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26191201
MIRT732068	hsa-miR-32-5p	Luciferase reporter assay, qRT-PCR, Western blot	26471298
MIRT732068	hsa-miR-32-5p	Luciferase reporter assay, qRT-PCR, Western blot	26471298
MIRT000308	hsa-miR-145-5p	Northern blot, qRT-PCR, Western blot	26197891
MIRT732242	hsa-miR-367-3p	Luciferase reporter assay, qRT-PCR, Western blot	27335771
MIRT732242	hsa-miR-367-3p	Luciferase reporter assay, qRT-PCR, Western blot	27335771
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	27431648
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	27431648
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	27431648
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	27431648
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	27431648
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	27431648
MIRT000308	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	26181633
MIRT054372	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25362853
MIRT054372	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25362853
MIRT756124	hsa-miR-92a-3p	Immunohistochemistry, qRT-PCR, Western blot	27411964
MIRT756124	hsa-miR-92a-3p	Immunohistochemistry, qRT-PCR, Western blot	27411964
MIRT756124	hsa-miR-92a-3p	Immunohistochemistry, qRT-PCR, Western blot	27411964
MIRT756124	hsa-miR-92a-3p	Immunohistochemistry, qRT-PCR, Western blot	27411964
MIRT732068	hsa-miR-32-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	27871067
MIRT732068	hsa-miR-32-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	27871067
MIRT732068	hsa-miR-32-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	27871067
MIRT732068	hsa-miR-32-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	27871067
MIRT054372	hsa-miR-34a-5p	Immunoblot, qRT-PCR	28250026
MIRT005440	hsa-miR-135b-5p	qRT-PCR	26877610
MIRT006688	hsa-miR-103a-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	28445396
MIRT006688	hsa-miR-103a-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	28445396
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assay	27669739
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assay	27669739
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assay, Western blot	27764757
MIRT003216	hsa-miR-10b-5p	Luciferase reporter assay, Western blot	27764757
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay	26172296
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay	26172296
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay	26172296
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay	26172296
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	28239300
MIRT054913	hsa-miR-7-5p	Luciferase reporter assay, qRT-PCR, Western blot	28239300
MIRT733581	hsa-miR-92b-3p	Luciferase reporter assay, qRT-PCR, Western blotting	31933825
MIRT733581	hsa-miR-92b-3p	Luciferase reporter assay, qRT-PCR, Western blotting	31933825
MIRT733581	hsa-miR-92b-3p	Luciferase reporter assay, qRT-PCR, Western blotting	31933825
MIRT733815	hsa-miR-451b	qRT-PCR, Western blotting	33725258
MIRT006688	hsa-miR-103a-3p	Luciferase reporter assay, qRT-PCR, RNA-seq, Western blotting	32061112
MIRT006692	hsa-miR-107	Western blotting, qRT-PCR	32674073
MIRT733581	hsa-miR-92b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31686859
MIRT053079	hsa-miR-15a-5p	qRT-PCR	32733962
MIRT006688	hsa-miR-103a-3p	Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR	32061112
MIRT756124	hsa-miR-92a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36601739
MIRT756124	hsa-miR-92a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36601739
MIRT756124	hsa-miR-92a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36214716
MIRT1096516	hsa-miR-1256	CLIP-seq
MIRT1096517	hsa-miR-1263	CLIP-seq
MIRT1096518	hsa-miR-128	CLIP-seq
MIRT1096519	hsa-miR-1292	CLIP-seq
MIRT1096520	hsa-miR-1297	CLIP-seq
MIRT1096521	hsa-miR-135a	CLIP-seq
MIRT1096522	hsa-miR-135b	CLIP-seq
MIRT1096523	hsa-miR-140-3p	CLIP-seq
MIRT1096524	hsa-miR-142-3p	CLIP-seq
MIRT1096525	hsa-miR-148a	CLIP-seq
MIRT1096526	hsa-miR-148b	CLIP-seq
MIRT1096527	hsa-miR-149	CLIP-seq
MIRT1096528	hsa-miR-152	CLIP-seq
MIRT1096529	hsa-miR-186	CLIP-seq
MIRT1096530	hsa-miR-219-5p	CLIP-seq
MIRT1096531	hsa-miR-25	CLIP-seq
MIRT1096532	hsa-miR-26a	CLIP-seq
MIRT1096533	hsa-miR-26b	CLIP-seq
MIRT1096534	hsa-miR-29a	CLIP-seq
MIRT1096535	hsa-miR-29b	CLIP-seq
MIRT1096536	hsa-miR-29c	CLIP-seq
MIRT1096537	hsa-miR-3064-5p	CLIP-seq
MIRT1096538	hsa-miR-3119	CLIP-seq
MIRT1096539	hsa-miR-3120-5p	CLIP-seq
MIRT1096540	hsa-miR-3133	CLIP-seq
MIRT1096541	hsa-miR-3140-5p	CLIP-seq
MIRT1096542	hsa-miR-3154	CLIP-seq
MIRT1096543	hsa-miR-3160-5p	CLIP-seq
MIRT1096544	hsa-miR-32	CLIP-seq
MIRT1096545	hsa-miR-346	CLIP-seq
MIRT1096546	hsa-miR-363	CLIP-seq
MIRT1096547	hsa-miR-3652	CLIP-seq
MIRT1096548	hsa-miR-3667-3p	CLIP-seq
MIRT1096549	hsa-miR-367	CLIP-seq
MIRT1096550	hsa-miR-3686	CLIP-seq
MIRT1096551	hsa-miR-378g	CLIP-seq
MIRT1096552	hsa-miR-4259	CLIP-seq
MIRT1096553	hsa-miR-4272	CLIP-seq
MIRT1096554	hsa-miR-4288	CLIP-seq
MIRT1096555	hsa-miR-4302	CLIP-seq
MIRT1096556	hsa-miR-4307	CLIP-seq
MIRT1096557	hsa-miR-4425	CLIP-seq
MIRT1096558	hsa-miR-4430	CLIP-seq
MIRT1096559	hsa-miR-4432	CLIP-seq
MIRT1096560	hsa-miR-4437	CLIP-seq
MIRT1096561	hsa-miR-4445	CLIP-seq
MIRT1096562	hsa-miR-4448	CLIP-seq
MIRT1096563	hsa-miR-4457	CLIP-seq
MIRT1096564	hsa-miR-4465	CLIP-seq
MIRT1096565	hsa-miR-4471	CLIP-seq
MIRT1096566	hsa-miR-4473	CLIP-seq
MIRT1096567	hsa-miR-4494	CLIP-seq
MIRT1096568	hsa-miR-4505	CLIP-seq
MIRT1096569	hsa-miR-4642	CLIP-seq
MIRT1096570	hsa-miR-4652-3p	CLIP-seq
MIRT1096571	hsa-miR-4659a-3p	CLIP-seq
MIRT1096572	hsa-miR-4659b-3p	CLIP-seq
MIRT1096573	hsa-miR-4674	CLIP-seq
MIRT1096574	hsa-miR-4680-3p	CLIP-seq
MIRT1096575	hsa-miR-4729	CLIP-seq
MIRT1096576	hsa-miR-4744	CLIP-seq
MIRT1096577	hsa-miR-4766-5p	CLIP-seq
MIRT1096578	hsa-miR-4778-3p	CLIP-seq
MIRT1096579	hsa-miR-4782-3p	CLIP-seq
MIRT1096580	hsa-miR-4794	CLIP-seq
MIRT1096581	hsa-miR-502-5p	CLIP-seq
MIRT1096582	hsa-miR-508-3p	CLIP-seq
MIRT1096583	hsa-miR-512-3p	CLIP-seq
MIRT1096584	hsa-miR-513b	CLIP-seq
MIRT1096585	hsa-miR-516a-3p	CLIP-seq
MIRT1096586	hsa-miR-520f	CLIP-seq
MIRT1096587	hsa-miR-548a-5p	CLIP-seq
MIRT1096588	hsa-miR-548ab	CLIP-seq
MIRT1096589	hsa-miR-548ak	CLIP-seq
MIRT1096590	hsa-miR-548b-5p	CLIP-seq
MIRT1096591	hsa-miR-548c-3p	CLIP-seq
MIRT1096592	hsa-miR-548c-5p	CLIP-seq
MIRT1096593	hsa-miR-548d-5p	CLIP-seq
MIRT1096594	hsa-miR-548h	CLIP-seq
MIRT1096595	hsa-miR-548i	CLIP-seq
MIRT1096596	hsa-miR-548j	CLIP-seq
MIRT1096597	hsa-miR-548n	CLIP-seq
MIRT1096598	hsa-miR-548w	CLIP-seq
MIRT1096599	hsa-miR-548y	CLIP-seq
MIRT1096600	hsa-miR-559	CLIP-seq
MIRT1096601	hsa-miR-570	CLIP-seq
MIRT1096602	hsa-miR-591	CLIP-seq
MIRT1096603	hsa-miR-632	CLIP-seq
MIRT1096604	hsa-miR-642a	CLIP-seq
MIRT1096605	hsa-miR-665	CLIP-seq
MIRT1096606	hsa-miR-7	CLIP-seq
MIRT1096607	hsa-miR-767-5p	CLIP-seq
MIRT1096608	hsa-miR-92a	CLIP-seq
MIRT1096609	hsa-miR-92b	CLIP-seq
MIRT1096610	hsa-miR-944	CLIP-seq
MIRT1096541	hsa-miR-3140-5p	CLIP-seq
MIRT1096550	hsa-miR-3686	CLIP-seq
MIRT1096556	hsa-miR-4307	CLIP-seq
MIRT1096570	hsa-miR-4652-3p	CLIP-seq
MIRT1096571	hsa-miR-4659a-3p	CLIP-seq
MIRT1096572	hsa-miR-4659b-3p	CLIP-seq
MIRT1096574	hsa-miR-4680-3p	CLIP-seq
MIRT1096578	hsa-miR-4778-3p	CLIP-seq
MIRT2026106	hsa-miR-1	CLIP-seq
MIRT2026107	hsa-miR-1200	CLIP-seq
MIRT2026108	hsa-miR-200b	CLIP-seq
MIRT2026109	hsa-miR-200c	CLIP-seq
MIRT1096531	hsa-miR-25	CLIP-seq
MIRT2026110	hsa-miR-3074-5p	CLIP-seq
MIRT1096539	hsa-miR-3120-5p	CLIP-seq
MIRT1096541	hsa-miR-3140-5p	CLIP-seq
MIRT1096544	hsa-miR-32	CLIP-seq
MIRT1096546	hsa-miR-363	CLIP-seq
MIRT1096549	hsa-miR-367	CLIP-seq
MIRT2026111	hsa-miR-3673	CLIP-seq
MIRT1096550	hsa-miR-3686	CLIP-seq
MIRT2026112	hsa-miR-3920	CLIP-seq
MIRT1096552	hsa-miR-4259	CLIP-seq
MIRT2026113	hsa-miR-429	CLIP-seq
MIRT1096556	hsa-miR-4307	CLIP-seq
MIRT2026114	hsa-miR-4320	CLIP-seq
MIRT1096563	hsa-miR-4457	CLIP-seq
MIRT1096570	hsa-miR-4652-3p	CLIP-seq
MIRT1096571	hsa-miR-4659a-3p	CLIP-seq
MIRT1096572	hsa-miR-4659b-3p	CLIP-seq
MIRT1096574	hsa-miR-4680-3p	CLIP-seq
MIRT2026115	hsa-miR-4704-3p	CLIP-seq
MIRT2026116	hsa-miR-4724-5p	CLIP-seq
MIRT1096578	hsa-miR-4778-3p	CLIP-seq
MIRT1096581	hsa-miR-502-5p	CLIP-seq
MIRT2026117	hsa-miR-511	CLIP-seq
MIRT1096584	hsa-miR-513b	CLIP-seq
MIRT2026118	hsa-miR-613	CLIP-seq
MIRT2026119	hsa-miR-656	CLIP-seq
MIRT1096606	hsa-miR-7	CLIP-seq
MIRT1096608	hsa-miR-92a	CLIP-seq
MIRT1096609	hsa-miR-92b	CLIP-seq
MIRT2257183	hsa-miR-1206	CLIP-seq
MIRT2257184	hsa-miR-1236	CLIP-seq
MIRT1096529	hsa-miR-186	CLIP-seq
MIRT2026108	hsa-miR-200b	CLIP-seq
MIRT2026109	hsa-miR-200c	CLIP-seq
MIRT1096531	hsa-miR-25	CLIP-seq
MIRT1096534	hsa-miR-29a	CLIP-seq
MIRT1096535	hsa-miR-29b	CLIP-seq
MIRT1096536	hsa-miR-29c	CLIP-seq
MIRT1096539	hsa-miR-3120-5p	CLIP-seq
MIRT2257185	hsa-miR-3128	CLIP-seq
MIRT1096540	hsa-miR-3133	CLIP-seq
MIRT2257186	hsa-miR-3182	CLIP-seq
MIRT1096544	hsa-miR-32	CLIP-seq
MIRT1096545	hsa-miR-346	CLIP-seq
MIRT2257187	hsa-miR-34a	CLIP-seq
MIRT2257188	hsa-miR-34c-5p	CLIP-seq
MIRT1096546	hsa-miR-363	CLIP-seq
MIRT1096549	hsa-miR-367	CLIP-seq
MIRT2257189	hsa-miR-3674	CLIP-seq
MIRT1096552	hsa-miR-4259	CLIP-seq
MIRT1096554	hsa-miR-4288	CLIP-seq
MIRT2026113	hsa-miR-429	CLIP-seq
MIRT1096555	hsa-miR-4302	CLIP-seq
MIRT1096559	hsa-miR-4432	CLIP-seq
MIRT2257190	hsa-miR-4452	CLIP-seq
MIRT1096567	hsa-miR-4494	CLIP-seq
MIRT2257191	hsa-miR-449a	CLIP-seq
MIRT2257192	hsa-miR-449b	CLIP-seq
MIRT1096574	hsa-miR-4680-3p	CLIP-seq
MIRT2257193	hsa-miR-4698	CLIP-seq
MIRT2257194	hsa-miR-4703-3p	CLIP-seq
MIRT2257195	hsa-miR-4720-5p	CLIP-seq
MIRT2026116	hsa-miR-4724-5p	CLIP-seq
MIRT1096575	hsa-miR-4729	CLIP-seq
MIRT1096576	hsa-miR-4744	CLIP-seq
MIRT2257196	hsa-miR-4753-3p	CLIP-seq
MIRT1096577	hsa-miR-4766-5p	CLIP-seq
MIRT2257197	hsa-miR-4799-3p	CLIP-seq
MIRT1096581	hsa-miR-502-5p	CLIP-seq
MIRT2257198	hsa-miR-520d-5p	CLIP-seq
MIRT2257199	hsa-miR-524-5p	CLIP-seq
MIRT1096587	hsa-miR-548a-5p	CLIP-seq
MIRT1096588	hsa-miR-548ab	CLIP-seq
MIRT1096589	hsa-miR-548ak	CLIP-seq
MIRT1096590	hsa-miR-548b-5p	CLIP-seq
MIRT1096591	hsa-miR-548c-3p	CLIP-seq
MIRT1096592	hsa-miR-548c-5p	CLIP-seq
MIRT1096593	hsa-miR-548d-5p	CLIP-seq
MIRT1096594	hsa-miR-548h	CLIP-seq
MIRT1096595	hsa-miR-548i	CLIP-seq
MIRT1096596	hsa-miR-548j	CLIP-seq
MIRT1096597	hsa-miR-548n	CLIP-seq
MIRT1096598	hsa-miR-548w	CLIP-seq
MIRT1096599	hsa-miR-548y	CLIP-seq
MIRT1096600	hsa-miR-559	CLIP-seq
MIRT2257200	hsa-miR-579	CLIP-seq
MIRT1096603	hsa-miR-632	CLIP-seq
MIRT1096606	hsa-miR-7	CLIP-seq
MIRT1096607	hsa-miR-767-5p	CLIP-seq
MIRT1096608	hsa-miR-92a	CLIP-seq
MIRT1096609	hsa-miR-92b	CLIP-seq
MIRT1096610	hsa-miR-944	CLIP-seq
MIRT1096518	hsa-miR-128	CLIP-seq
MIRT1096523	hsa-miR-140-3p	CLIP-seq
MIRT1096525	hsa-miR-148a	CLIP-seq
MIRT1096526	hsa-miR-148b	CLIP-seq
MIRT1096528	hsa-miR-152	CLIP-seq
MIRT1096539	hsa-miR-3120-5p	CLIP-seq
MIRT1096545	hsa-miR-346	CLIP-seq
MIRT1096554	hsa-miR-4288	CLIP-seq
MIRT1096567	hsa-miR-4494	CLIP-seq
MIRT1096603	hsa-miR-632	CLIP-seq
MIRT2026107	hsa-miR-1200	CLIP-seq
MIRT1096518	hsa-miR-128	CLIP-seq
MIRT1096519	hsa-miR-1292	CLIP-seq
MIRT1096523	hsa-miR-140-3p	CLIP-seq
MIRT1096524	hsa-miR-142-3p	CLIP-seq
MIRT1096525	hsa-miR-148a	CLIP-seq
MIRT1096526	hsa-miR-148b	CLIP-seq
MIRT1096527	hsa-miR-149	CLIP-seq
MIRT1096528	hsa-miR-152	CLIP-seq
MIRT1096529	hsa-miR-186	CLIP-seq
MIRT2558520	hsa-miR-2116	CLIP-seq
MIRT1096530	hsa-miR-219-5p	CLIP-seq
MIRT1096537	hsa-miR-3064-5p	CLIP-seq
MIRT2026110	hsa-miR-3074-5p	CLIP-seq
MIRT1096539	hsa-miR-3120-5p	CLIP-seq
MIRT1096540	hsa-miR-3133	CLIP-seq
MIRT1096543	hsa-miR-3160-5p	CLIP-seq
MIRT1096545	hsa-miR-346	CLIP-seq
MIRT1096547	hsa-miR-3652	CLIP-seq
MIRT1096548	hsa-miR-3667-3p	CLIP-seq
MIRT1096551	hsa-miR-378g	CLIP-seq
MIRT2026112	hsa-miR-3920	CLIP-seq
MIRT2558521	hsa-miR-409-3p	CLIP-seq
MIRT1096552	hsa-miR-4259	CLIP-seq
MIRT1096554	hsa-miR-4288	CLIP-seq
MIRT2026114	hsa-miR-4320	CLIP-seq
MIRT1096557	hsa-miR-4425	CLIP-seq
MIRT1096558	hsa-miR-4430	CLIP-seq
MIRT1096560	hsa-miR-4437	CLIP-seq
MIRT1096561	hsa-miR-4445	CLIP-seq
MIRT1096562	hsa-miR-4448	CLIP-seq
MIRT1096563	hsa-miR-4457	CLIP-seq
MIRT1096565	hsa-miR-4471	CLIP-seq
MIRT1096566	hsa-miR-4473	CLIP-seq
MIRT1096567	hsa-miR-4494	CLIP-seq
MIRT1096568	hsa-miR-4505	CLIP-seq
MIRT1096573	hsa-miR-4674	CLIP-seq
MIRT2558522	hsa-miR-4677-5p	CLIP-seq
MIRT1096576	hsa-miR-4744	CLIP-seq
MIRT1096579	hsa-miR-4782-3p	CLIP-seq
MIRT1096580	hsa-miR-4794	CLIP-seq
MIRT1096582	hsa-miR-508-3p	CLIP-seq
MIRT2026117	hsa-miR-511	CLIP-seq
MIRT1096583	hsa-miR-512-3p	CLIP-seq
MIRT1096584	hsa-miR-513b	CLIP-seq
MIRT1096586	hsa-miR-520f	CLIP-seq
MIRT1096591	hsa-miR-548c-3p	CLIP-seq
MIRT2558523	hsa-miR-556-3p	CLIP-seq
MIRT1096602	hsa-miR-591	CLIP-seq
MIRT1096603	hsa-miR-632	CLIP-seq
MIRT1096604	hsa-miR-642a	CLIP-seq
MIRT2026119	hsa-miR-656	CLIP-seq
MIRT1096606	hsa-miR-7	CLIP-seq
MIRT1096518	hsa-miR-128	CLIP-seq
MIRT1096523	hsa-miR-140-3p	CLIP-seq
MIRT1096525	hsa-miR-148a	CLIP-seq
MIRT1096526	hsa-miR-148b	CLIP-seq
MIRT1096528	hsa-miR-152	CLIP-seq
MIRT1096529	hsa-miR-186	CLIP-seq
MIRT2558520	hsa-miR-2116	CLIP-seq
MIRT1096539	hsa-miR-3120-5p	CLIP-seq
MIRT1096540	hsa-miR-3133	CLIP-seq
MIRT1096545	hsa-miR-346	CLIP-seq
MIRT1096554	hsa-miR-4288	CLIP-seq
MIRT2026114	hsa-miR-4320	CLIP-seq
MIRT1096567	hsa-miR-4494	CLIP-seq
MIRT2558522	hsa-miR-4677-5p	CLIP-seq
MIRT1096576	hsa-miR-4744	CLIP-seq
MIRT2026117	hsa-miR-511	CLIP-seq
MIRT1096591	hsa-miR-548c-3p	CLIP-seq
MIRT2558523	hsa-miR-556-3p	CLIP-seq
MIRT1096603	hsa-miR-632	CLIP-seq
MIRT2026119	hsa-miR-656	CLIP-seq

Transcription factors

Show/Hide all(11)

Transcription factor	Regulation	Reference
APC	Unknown	12387883
CDX2	Activation	11521200
CDX2	Unknown	23202735
HDAC1	Repression	15051827
HDAC2	Repression	19486889
HDAC4	Unknown	21118993
PPARG	Unknown	23275339
RUNX1	Unknown	19328795
SOX9	Unknown	18977346
TCF4	Unknown	18977346
TP63	Repression	20972454

Show/Hide all(117)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	20551324
GO:0000785	Component	Chromatin	IDA	21539536
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	20629177, 21539536
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001010	Function	RNA polymerase II sequence-specific DNA-binding transcription factor recruiting activity	IEA
GO:0001010	Function	RNA polymerase II sequence-specific DNA-binding transcription factor recruiting activity	ISS
GO:0001221	Function	Transcription coregulator binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	21539536
GO:0002357	Process	Defense response to tumor cell	IMP	30429596
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	20629177
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	9422764
GO:0003700	Function	DNA-binding transcription factor activity	TAS	10431239
GO:0005515	Function	Protein binding	IPI	19751731, 24048479, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007500	Process	Mesodermal cell fate determination	TAS	8940147
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	NAS	9422764
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	8702718
GO:0008544	Process	Epidermis development	IEA
GO:0009913	Process	Epidermal cell differentiation	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IGI	22267480
GO:0010629	Process	Negative regulation of gene expression	IGI	22267480
GO:0014740	Process	Negative regulation of muscle hyperplasia	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	23867820
GO:0019827	Process	Stem cell population maintenance	IEA
GO:0019827	Process	Stem cell population maintenance	ISS
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0031077	Process	Post-embryonic camera-type eye development	IEA
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0032206	Process	Positive regulation of telomere maintenance	IDA	20629177
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032717	Process	Negative regulation of interleukin-8 production	IDA	20551324
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	IDA	20551324
GO:0035014	Function	Phosphatidylinositol 3-kinase regulator activity	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035166	Process	Post-embryonic hemopoiesis	IMP	21539536
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	20551324
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IMP	22430140
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045444	Process	Fat cell differentiation	ISS
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045595	Process	Regulation of cell differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	9422764
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	27431648
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	9422764
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20629177
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	20551324
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	22430140, 22723415, 27907090
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0046985	Process	Positive regulation of hemoglobin biosynthetic process	IMP	21539536
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IEA
GO:0048679	Process	Regulation of axon regeneration	IEA
GO:0048730	Process	Epidermis morphogenesis	IEA
GO:0050728	Process	Negative regulation of inflammatory response	TAS	20551324
GO:0051247	Process	Positive regulation of protein metabolic process	IGI	20551324
GO:0051247	Process	Positive regulation of protein metabolic process	IMP	22430140
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060761	Process	Negative regulation of response to cytokine stimulus	IDA	20551324
GO:0061436	Process	Establishment of skin barrier	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	21539536
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	ISS
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IDA	20551324
GO:0071499	Process	Cellular response to laminar fluid shear stress	IMP	22430140
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	IDA	20551324
GO:0106222	Function	LncRNA binding	IEA
GO:0120222	Process	Regulation of blastocyst development	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	23867820
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IGI	27431648
GO:1904998	Process	Negative regulation of leukocyte adhesion to arterial endothelial cell	IGI	22267480
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990841	Function	Promoter-specific chromatin binding	IDA	27907090
GO:1990859	Process	Cellular response to endothelin	IEA
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IDA	23867820
GO:2000342	Process	Negative regulation of chemokine (C-X-C motif) ligand 2 production	IDA	20551324
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	20551324

MIM	HGNC	e!Ensembl
602253	6348	ENSG00000136826

Protein

UniProt ID

O43474

Protein name

Krueppel-like factor 4 (Epithelial zinc finger protein EZF) (Gut-enriched krueppel-like factor)

Protein function

Transcription factor; can act both as activator and as repressor. Binds the 5'-CACCC-3' core sequence. Binds to the promoter region of its own gene and can activate its own transcription. Regulates the expression of key transcription factors dur

PDB

6VTX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	430 → 454	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	460 → 484	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	490 → 512	Zinc finger, C2H2 type	Domain

Sequence

MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPG
RPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESV
AATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTGGGLLYGRESAPP
PTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGS
EYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRP
AAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQV
PPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRR
SWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRH
YRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF

Sequence length

513

Interactions

View interactions

	KEGG		Reactome
	Signaling pathways regulating pluripotency of stem cells Chemical carcinogenesis - receptor activation		Synthesis, secretion, and deacylation of Ghrelin Transcriptional regulation of pluripotent stem cells

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (210)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	28751461
Adenocarcinoma of Lung	Associate	33661044, 37287976
Adenoma	Associate	35750256
Adenomatous Polyposis Coli	Inhibit	11521200
Adenomatous Polyps	Inhibit	11005769
Adrenoleukodystrophy	Associate	29065337
Alzheimer Disease	Associate	29753274, 31401456, 31698192, 37549144
Ameloblastoma	Associate	37559082
Aneurysm	Associate	27720318, 30792063
Anophthalmia with pulmonary hypoplasia	Associate	27802195
Aortic Aneurysm Abdominal	Associate	39321955
Aortic Aneurysm Thoracic	Stimulate	35563123
Arthritis Rheumatoid	Associate	27413250
Atherosclerosis	Associate	20718868, 36470917, 40362576
Autism Spectrum Disorder	Associate	34438162
Bacterial Infections	Associate	35751107
Barrett Esophagus	Associate	25558829, 28751461
Bowen's Disease	Associate	18376139
Brain Neoplasms	Associate	26689941
Breast Neoplasms	Associate	11551969, 18376139, 21242971, 21586797, 21674249, 22389506, 23926105, 25879941, 26420673, 26729194, 26840086, 27323810, 28422735, 28423718, 29782654 View all (6 more)
Breast Neoplasms	Inhibit	20356845, 31640084
Bronchopulmonary Dysplasia	Inhibit	35950640
Burkitt Lymphoma	Associate	26431332
Calcinosis Cutis	Stimulate	28412746
Carcinogenesis	Inhibit	12387883
Carcinogenesis	Associate	16046710, 16357509, 20356845, 20699379, 21242971, 22284679, 22389506, 24551169, 25169491, 26420673, 26934576, 27131314, 29665649, 31653828, 32126149, 37243389, 39986058 View all (2 more)
Carcinogenesis	Stimulate	21242971, 34440860
Carcinoid Tumor	Associate	24978920
Carcinoma Embryonal	Associate	25464862
Carcinoma Hepatocellular	Associate	24897024, 26540347, 27102441, 27728962, 27894081, 27909734, 28028181, 28192402, 29252002, 29425759, 30664155, 30672133, 31127852, 31182916, 31543683, 31653828, 32350244, 32756012 View all (3 more)
Carcinoma Hepatocellular	Inhibit	34114341
Carcinoma in Situ	Stimulate	21674249
Carcinoma in Situ	Inhibit	22170594
Carcinoma Intraductal Noninfiltrating	Associate	33452133
Carcinoma Non Small Cell Lung	Associate	29568911, 29665649, 34440860, 35098684, 35982899
Carcinoma Pancreatic Ductal	Associate	21224073
Carcinoma Renal Cell	Inhibit	21982273
Carcinoma Renal Cell	Associate	35585131, 36214716
Carcinoma Squamous Cell	Associate	18376139, 26934576, 28639905
Cardiovascular Diseases	Associate	24184689
Cell Transformation Neoplastic	Associate	32802869
Cell Transformation Viral	Inhibit	35450883
Charcot Marie Tooth Disease	Associate	29034895
Colitis Associated Neoplasms	Associate	35733095
Colitis Ulcerative	Associate	35733095
Colonic Diseases	Inhibit	11005769, 11521200
Colonic Neoplasms	Associate	32428045
Colorectal Neoplasms	Inhibit	10908361, 12387883, 18376139, 20699379, 22284679, 25060774, 28218782
Colorectal Neoplasms	Associate	14724568, 15051827, 19551868, 22389506, 22703586, 27131314, 28710230, 29197895, 29794245, 30287917, 31032663, 31169949, 31830379, 32012389, 32802869 View all (4 more)
Coronary Restenosis	Associate	36601739
Coxa Magna	Associate	36530027
Cryptorchidism	Associate	23025704
Cystic Fibrosis	Inhibit	32630830
Cystic Fibrosis	Associate	32777768, 32937756, 36067639
Dermatomyositis	Associate	24288551
Diabetes Mellitus	Associate	39321955
Diabetes Mellitus Type 2	Associate	37028179
Diabetic Nephropathies	Associate	34735495
Down Syndrome	Associate	33220594
Dyslipidemias	Associate	27199507
Dysplastic Nevus Syndrome	Inhibit	11005769
Encephalomyelitis Equine	Associate	30404192
Encephalomyelitis Venezuelan Equine	Associate	30404192
Endocrine System Diseases	Associate	32084531
Endometrial Hyperplasia	Associate	30221668
Endometrial Neoplasms	Associate	21543766, 21851624, 30221668
Endometrial Neoplasms	Inhibit	27098518
Epidermolysis bullosa simplex Ogna type	Associate	28675510
Epithelial Squamous Dysplasia Keratinizing Desquamative of Urinary Tract	Associate	26097551
Epstein Barr Virus Infections	Associate	26431332
Esophageal Neoplasms	Associate	16357509
Esophageal Neoplasms	Inhibit	20075075
Esophageal Squamous Cell Carcinoma	Associate	25400747, 25851906, 26934576, 28694421, 30207835
Fatty Liver	Associate	27789406, 27789412, 34114341
Fatty Liver Alcoholic	Stimulate	29425759
Fetal Growth Retardation	Associate	35090410
Gastrointestinal Neoplasms	Associate	32084531
Germinoma	Associate	20178649
Giant Cell Arteritis	Associate	34204585
Glaucoma 3 Primary Congenital A	Associate	29453128
Glioblastoma	Associate	28553926, 29507094, 30058478, 33762574
Glioma	Associate	37243389
Glycogen Storage Disease Type IV	Stimulate	27802195
HAIR AN syndrome	Associate	32197467
Hay Wells syndrome	Inhibit	35950640
Head and Neck Neoplasms	Associate	32019273
Helicobacter Infections	Inhibit	32017451
Hemangioma Cavernous Central Nervous System	Inhibit	40362576
Hepatitis Alcoholic	Associate	29425759
Hepatitis B	Inhibit	27909734
Hereditary Breast and Ovarian Cancer Syndrome	Associate	22389506, 26420673, 27323810
Hirschsprung Disease	Associate	36214716
HIV Infections	Stimulate	31779701
Hodgkin Disease	Associate	20519630
Hyperoxia	Associate	35950640
Hyperplasia	Associate	30221668
Hypoxia	Stimulate	21712410, 36791645, 37768037
Hypoxia	Associate	33762574
Inflammation	Associate	27413250, 27742396, 34236821, 34440860, 34685528, 35293599, 35363406
Inflammation	Inhibit	37506161
Intervertebral Disc Degeneration	Inhibit	35266272
Intestinal Diseases	Associate	33200654
Intestinal Failure	Associate	37375564
Keratoderma Palmoplantar	Associate	35168889
Kidney Neoplasms	Associate	37047552
Klatskin Tumor	Associate	37937607
Knee Injuries	Associate	33749514
Leukemia	Associate	20401760, 33219287
Leukemia	Inhibit	30792202
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	20401760
Leukemia Myeloid	Associate	26644403
Leukemia Myeloid Acute	Inhibit	26644403
Leukemia Myeloid Acute	Associate	28359056, 32811810, 33219287, 37143070
Leukemia Promyelocytic Acute	Associate	35450883
Leukoplakia Hairy	Associate	26431332
Livedoid Vasculopathy	Associate	22420764
Liver Diseases	Associate	34114341
Lung Diseases	Associate	35852857
Lung Neoplasms	Inhibit	20215880
Lung Neoplasms	Associate	24978920, 27296948, 34440860
Lymphatic Metastasis	Associate	25400747
Lymphatic Metastasis	Inhibit	26097551, 28218782
Lymphoma	Associate	20519630, 25612624, 34751409
Lymphoma B Cell	Associate	20519630
Lymphoma B Cell Marginal Zone	Associate	25612624
Lymphoma Follicular	Associate	22102710, 28324774
Lymphoma Large B Cell Diffuse	Associate	28324774
Lymphoma Non Hodgkin	Associate	34452555
Machado Joseph Disease	Associate	27346190
Macrophage Activation Syndrome	Associate	37020848
Malabsorption Syndromes	Associate	37375564
Melanoma	Associate	28412746
Meningioma	Associate	25993161, 27102344, 27548314, 33068421, 33772057
Metaplasia	Associate	25558829
Mouth Neoplasms	Associate	26097551, 34092609
Mouth Neoplasms	Inhibit	26847634
Mucopolysaccharidosis VI	Associate	38006675
Multiple Myeloma	Inhibit	23585530
Multiple Myeloma	Associate	26109433, 33757979, 35669651, 36752202
Multiple Pterygium Syndrome Autosomal Dominant	Associate	35168889
Multiple Sclerosis	Associate	23585530
Mycoses	Associate	27346433
Myoclonic Epilepsies Progressive	Associate	31374462
Myositis Ossificans	Associate	37307755
Nasopharyngeal Carcinoma	Associate	29973197
Necrosis	Associate	36530027
Neoplasm Invasiveness	Associate	21674249
Neoplasm Metastasis	Associate	16357509, 18376139, 28028181, 28639905, 31426719, 34108011, 35982899, 36214716, 36539799, 36786527
Neoplasm Metastasis	Inhibit	20215880, 20356845, 21159640, 27909734
Neoplasms	Inhibit	11005769, 11521200, 18376139, 20075075, 20215880, 20356845, 20519630, 20699379, 21159640, 21224073, 21982273, 22170594, 23317647, 23585530, 24551169 View all (24 more)
Neoplasms	Associate	11521200, 14724568, 17017123, 19268426, 20442780, 21242971, 21586797, 21674249, 22389506, 23376074, 23921950, 24065485, 24796549, 25024430, 25060774 View all (31 more)
Neoplasms	Stimulate	21242971
Neoplasms Squamous Cell	Inhibit	16357509, 26934576
Neurilemmoma	Associate	33222917
Neuroblastoma	Associate	19458492, 19495417, 23317647
Neurodegenerative Diseases	Associate	29849909
Neuroendocrine Tumors	Associate	24978920
Neurofibromatosis 2	Associate	23348505
Neuronal intranuclear inclusion disease	Associate	35772299
Niemann Pick Disease Type C	Associate	33099109
Non alcoholic Fatty Liver Disease	Inhibit	34114341
Obesity	Associate	27199507, 34214899
Olfaction Disorders	Associate	27878761
Olivopontocerebellar Atrophies	Associate	22301348
Oncogene Addiction	Associate	29133945
Ornithine Carbamoyltransferase Deficiency Disease	Associate	33550136
Oropharyngeal Neoplasms	Associate	18376139
Osteoarthritis	Associate	30081074, 32144293
Osteosarcoma	Associate	26676883, 33008481, 34696664, 36539799
Ovarian Neoplasms	Associate	25137052, 25169491, 31514068, 32362568
Pancreatic Intraductal Neoplasms	Associate	33028669
Pancreatic Neoplasms	Associate	21224073, 27802195, 34675409, 40303408
Pancreatitis	Associate	21224073
Parkinson Disease	Associate	38615589
Pediatric acute onset neuropsychiatric syndrome	Associate	27878761
Personality Disorders	Associate	28422735
Polycythemia Vera	Associate	20601445
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	25037230
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	25037230, 35488386
Prostatic Neoplasms	Associate	18314491, 29017567, 30176890, 31746380, 33279858, 35512605
Prostatic Neoplasms	Inhibit	18376139, 21159640
Psoriasis	Associate	31996098
Pulmonary Disease Chronic Obstructive	Associate	34145303
Pulmonary Fibrosis	Inhibit	35852857
Reperfusion Injury	Associate	37506161
Respiratory Tract Diseases	Associate	31172816
Retinal Dysplasia	Associate	26934576
Retinitis Pigmentosa	Associate	23197854, 28677533
Rett Syndrome	Associate	21807996
Rhinitis Allergic	Associate	37206297
Sepsis	Associate	33200654
Skull Base Neoplasms	Associate	28482067
Small Cell Lung Carcinoma	Associate	32176034
Spastic paraplegia 20 autosomal recessive	Associate	34751409
Squamous Cell Carcinoma of Head and Neck	Associate	32432743, 33802627, 35219646, 38096163
Squamous Cell Carcinoma of Head and Neck	Inhibit	35363406
Stomach Neoplasms	Associate	21075859, 24065485, 24763828, 26191201, 35670736, 35874675, 39293524
Stomach Neoplasms	Inhibit	23884787, 32017451
Teratoma	Associate	33799273
Thrombosis	Associate	40362576
Thymoma	Associate	34104648
Thyroid Carcinoma Anaplastic	Associate	23301671
Triple Negative Breast Neoplasms	Associate	25202123, 32552913, 33918002, 37762678
Triple Negative Breast Neoplasms	Inhibit	39938698
Urinary Bladder Neoplasms	Associate	26729194, 27456363, 28380435, 28720065, 32126149, 38129585
Uterine Cervical Neoplasms	Inhibit	22170594, 24551169
Uterine Cervical Neoplasms	Associate	25119587, 28639905, 38537385
Uterine Diseases	Associate	30221668
Ventricular Remodeling	Associate	34562312
von Hippel Lindau Disease	Associate	32084531

KLF4 (KLF transcription factor 4)