Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9312
Gene name	Potassium voltage-gated channel subfamily B member 2
Gene symbol	KCNB2
Synonyms (NCBI Gene)	KV2.2
Chromosome	8
Chromosome location	8q21.11
Summary	Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro

Show/Hide all (10)

miRTarBase ID	miRNA	Experiments	Reference
MIRT440406	hsa-miR-493-3p	HITS-CLIP	24374217
MIRT440406	hsa-miR-493-3p	HITS-CLIP	24374217
MIRT1080446	hsa-miR-2052	CLIP-seq
MIRT1080447	hsa-miR-2116	CLIP-seq
MIRT1080448	hsa-miR-4677-5p	CLIP-seq
MIRT1080449	hsa-miR-4704-3p	CLIP-seq
MIRT2019985	hsa-miR-1208	CLIP-seq
MIRT1080447	hsa-miR-2116	CLIP-seq
MIRT1080448	hsa-miR-4677-5p	CLIP-seq
MIRT1080449	hsa-miR-4704-3p	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001508	Process	Action potential	IBA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005249	Function	Voltage-gated potassium channel activity	IEA
GO:0005251	Function	Delayed rectifier potassium channel activity	ISS
GO:0005251	Function	Delayed rectifier potassium channel activity	TAS	9612272
GO:0005267	Function	Potassium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	33124732
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	ISS
GO:0006813	Process	Potassium ion transport	TAS	9612272
GO:0006940	Process	Regulation of smooth muscle contraction	TAS	9612272
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	ISS
GO:0008076	Component	Voltage-gated potassium channel complex	TAS	9612272
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0032809	Component	Neuronal cell body membrane	ISS
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IBA
GO:0043204	Component	Perikaryon	IEA
GO:0046982	Function	Protein heterodimerization activity	ISS
GO:0051260	Process	Protein homooligomerization	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	ISS
GO:0072659	Process	Protein localization to plasma membrane	ISS

MIM	HGNC	e!Ensembl
607738	6232	ENSG00000182674

Q92953

Protein name

Potassium voltage-gated channel subfamily B member 2 (Voltage-gated potassium channel subunit Kv2.2)

Protein function

Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and smooth muscle cells. Channels open or close in response to the voltage difference across the membrane, letting pot

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02214	BTB_2	37 → 136	BTB/POZ domain	Domain
PF00520	Ion_trans	192 → 428	Ion transport protein	Family
PF03521	Kv2channel	471 → 759	Kv2 voltage-gated K+ channel	Family

Sequence

MAEKAPPGLNRKTSRSTLSLPPEPVDIIRSKTCSRRVKINVGGLNHEVLWRTLDRLPRTR
LGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFG
QELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPDKRKKLW
DLLEKPNSSVAAKILAIVSILFIVLSTIALSLNTLPELQETDEFGQLNDNRQLAHVEAVC
IAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSVLQFQNVRRVV
QIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDE
DATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNF
SEFYKEQKRQEKAIKRREALERAKRNGSIVSMNLKDAFARSMELIDVAVEKAGESANTKD
SADDNHLSPSRWKWARKALSETSSNKSFENKYQEVSQKDSHEQLNNTSSSSPQHLSAQKL
EMLYNEITKTQPHSHPNPDCQEKPERPSAYEEEIEMEEVVCPQEQLAVAQTEVIVDMKST
SSIDSFTSCATDFTETERSPLPPPSASHLQMKFPTDLPGTEEHQRARGPPFLTLSREKGP
AARDGTLEYAPVDITVNLDASGSQCGLHSPLQSDNATDSPKSSLKGSNPLKSRSLKVNFK
ENRGSAPQTPPSTARPLPVTTADFSLTTPQHISTILLEETPSQGDRPLLGTEVSAPCQGP
SKGLSPRFPKQKLFPFSSRERRSFTEIDTGDDEDFLELPGAREEKQVDSSPNCFADKPSD
GRDPLREEGSVGSSSPQDTGHNCRQDIYHAVSEVKKDSSQEGCKMENHLFAPEIHSNPGD
TGYCPTRETSM

Sequence length

911

Interactions

View interactions

	Reactome
			Voltage gated Potassium channels

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Colorectal cancer	risk factor	rs2919408	RCV002280590
KCNB2-related disorder	Benign; Likely benign	rs11782118, rs41272419, rs763584250, rs142525254, rs138896608, rs2487564423, rs34259157	RCV003983997 RCV003968484 RCV003974157 RCV003914094 RCV003944777 RCV003969217 RCV003913286
Uterine carcinosarcoma	Conflicting classifications of pathogenicity	rs747695999	RCV005929187

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	24416132
Brugada Syndrome	Associate	25339316
Death Sudden Cardiac	Associate	25339316

KCNB2 (potassium voltage-gated channel subfamily B member 2)