Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	93107
Gene name Gene Name - the full gene name approved by the HGNC.	Potassium voltage-gated channel modifier subfamily G member 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KCNG4
Synonyms (NCBI Gene) Gene synonyms aliases	KV6.3, KV6.4
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q24.1
Summary Summary of gene provided in NCBI Entrez Gene.	Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments
MIRT1080982	hsa-miR-1182	CLIP-seq
MIRT1080983	hsa-miR-1237	CLIP-seq
MIRT1080984	hsa-miR-1248	CLIP-seq
MIRT1080985	hsa-miR-193a-5p	CLIP-seq
MIRT1080986	hsa-miR-217	CLIP-seq
MIRT1080987	hsa-miR-3162-5p	CLIP-seq
MIRT1080988	hsa-miR-3173-3p	CLIP-seq
MIRT1080989	hsa-miR-3670	CLIP-seq
MIRT1080990	hsa-miR-4268	CLIP-seq
MIRT1080991	hsa-miR-4418	CLIP-seq
MIRT1080992	hsa-miR-4448	CLIP-seq
MIRT1080993	hsa-miR-4476	CLIP-seq
MIRT1080994	hsa-miR-4533	CLIP-seq
MIRT1080995	hsa-miR-4699-3p	CLIP-seq
MIRT1080996	hsa-miR-4763-5p	CLIP-seq
MIRT1080997	hsa-miR-4779	CLIP-seq
MIRT1080998	hsa-miR-509-3-5p	CLIP-seq
MIRT1080999	hsa-miR-509-5p	CLIP-seq
MIRT1081000	hsa-miR-526b	CLIP-seq
MIRT2020072	hsa-miR-1243	CLIP-seq
MIRT2020073	hsa-miR-1252	CLIP-seq
MIRT2020074	hsa-miR-1261	CLIP-seq
MIRT2020075	hsa-miR-3123	CLIP-seq
MIRT2020076	hsa-miR-3169	CLIP-seq
MIRT2020077	hsa-miR-3591-3p	CLIP-seq
MIRT2020078	hsa-miR-4311	CLIP-seq
MIRT2020079	hsa-miR-4434	CLIP-seq
MIRT2020080	hsa-miR-4437	CLIP-seq
MIRT2020081	hsa-miR-4515	CLIP-seq
MIRT2020082	hsa-miR-4516	CLIP-seq
MIRT2020083	hsa-miR-4531	CLIP-seq
MIRT1080994	hsa-miR-4533	CLIP-seq
MIRT2020084	hsa-miR-4646-5p	CLIP-seq
MIRT2020085	hsa-miR-4731-5p	CLIP-seq
MIRT2020086	hsa-miR-4747-5p	CLIP-seq
MIRT2020087	hsa-miR-582-3p	CLIP-seq

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001508	Process	Action potential	IBA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005249	Function	Voltage-gated potassium channel activity	IEA
GO:0005267	Function	Potassium channel activity	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA	12060745, 19074135
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	19074135
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	IDA	12060745, 19074135
GO:0015459	Function	Potassium channel regulator activity	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0043266	Process	Regulation of potassium ion transport	IDA	12060745
GO:0044325	Function	Transmembrane transporter binding	IPI	19074135
GO:0051260	Process	Protein homooligomerization	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IDA	19074135

MIM	HGNC	e!Ensembl
607603	19697	ENSG00000168418

Protein

UniProt ID

Q8TDN1

Protein name

Voltage-gated potassium channel regulatory subunit KCNG4 (Potassium voltage-gated channel subfamily G member 4) (Voltage-gated potassium channel subunit Kv6.3) (Voltage-gated potassium channel subunit Kv6.4)

Protein function

Regulatory subunit of the voltage-gated potassium (Kv) channel which, when coassembled with KCNB1, modulates the kinetics parameters of the heterotetrameric channel namely the time course of activation, deactivation and inactivation and on the v

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02214	BTB_2	61 → 160	BTB/POZ domain	Domain
PF00520	Ion_trans	220 → 464	Ion transport protein	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain, and at lower levels in liver, small intestine and colon. {ECO:0000269|PubMed:12060745}.

Sequence

MPMPSRDGGLHPRHHHYGSHSPWSQLLSSPMETPSIKGLYYRRVRKVGALDASPVDLKKE
ILINVGGRRYLLPWSTLDRFPLSRLSKLRLCRSYEEIVQLCDDYDEDSQEFFFDRSPSAF
GVIVSFLAAGKLVLLQEMCALSFQEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHR
EDVLRQQRETRRPASHSSRWGLCMNRLREMVENPQSGLPGKVFACLSILFVATTAVSLCV
STMPDLRAEEDQGECSRKCYYIFIVETICVAWFSLEFCLRFVQAQDKCQFFQGPLNIIDI
LAISPYYVSLAVSEEPPEDGERPSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTL
GLTVRRCTREFGLLLLFLAVAITLFSPLVYVAEKESGRVLEFTSIPASYWWAIISMTTVG
YGDMVPRSVPGQMVALSSILSGILIMAFPATSIFHTFSHSYLELKKEQEQLQARLRHLQN
TGPASECELLDPHVASEHELMNDVNDLILEGPALPIMHM

Sequence length

519

Interactions

View interactions

	Reactome
			Voltage gated Potassium channels

KCNG4 (potassium voltage-gated channel modifier subfamily G member 4)