Gene Gene information from NCBI Gene database.
Entrez ID 93099
Gene name Dermokine
Gene symbol DMKN
Synonyms (NCBI Gene)
UNQ729ZD52F10
Chromosome 19
Chromosome location 19q13.12
Summary This gene is upregulated in inflammatory diseases, and it was first observed as expressed in the differentiated layers of skin. The most interesting aspect of this gene is the differential use of promoters and terminators to generate isoforms with unique
miRNA miRNA information provided by mirtarbase database.
119
miRTarBase ID miRNA Experiments Reference
MIRT027972 hsa-miR-93-5p Sequencing 20371350
MIRT045834 hsa-miR-138-5p CLASH 23622248
MIRT514913 hsa-miR-1273g-3p PAR-CLIP 21572407
MIRT514911 hsa-miR-6849-3p PAR-CLIP 21572407
MIRT514912 hsa-miR-6742-3p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 22735594, 32296183
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:1903575 Process Cornified envelope assembly IBA
GO:1903575 Process Cornified envelope assembly IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617211 25063 ENSG00000161249
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6E0U4
Protein name Dermokine (Epidermis-specific secreted protein SK30/SK89)
Protein function May act as a soluble regulator of keratinocyte differentiation.
PDB 4F20
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in epidermis; in the spinous and granular layers and in placenta. Also found in the epithelia of the small intestine, macrophages of the lung and endothelial cells of the lung. Isoform 15 is expressed in epidermis and placent
Sequence
MKFQGPLACLLLALCLGSGEAGPLQSGEESTGTNIGEALGHGLGDALSEGVGKAIGKEAG
GAAGSKVSEALGQGTREAVGTGVRQVPGFGVADALGNRVGEAAHALGNTGHEIGRQAEDV
IRHGADAVRGSWQGVPGHNGAWETSGGHGIFGSQGGLGGQGQGNPGGLGTPWVHGYPGNS
AGSFGMNPQGAPWGQGGNGGPPNFGTNTQGAVAQPGYGSVRASNQNEGCTNPPPSGSGGG
SSNSGGGSGSQSGSSGSGSNGDNNNGSSSGGSSSGSSSGGSSGGSSGGSSGNSGGSRGDS
GSESSWGSSTGSSSGNHGGSGGGNGHKPGCEKPGNEARGSGESGIQNSETSPGMFNFDTF
WKNFKSKLGFINWDAINKNQVPPPSTRALLYFSRLWEDFKQNTPFLNWKAIIEGADASSL
QKRAGRDDQNYNYNQHAYPTAYGGKYSVKTPAKGGVSPSSSASRVQPGLLQWVKFW
Sequence length 476
Interactions View interactions