Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	92960
Gene name	Peroxisomal biogenesis factor 11 gamma
Gene symbol	PEX11G
Synonyms (NCBI Gene)	PEX11gamma
Chromosome	19
Chromosome location	19p13.2
Summary	The protein encoded by this gene is a member of the PEX11 family. This family is reported to regulate the number and size of peroxisomes in evolutionarily distant organisms. The protein encoded by this gene may induce clustering of peroxisomes. Alternativ

Show/Hide all (7)

miRTarBase ID	miRNA	Experiments
MIRT2591598	hsa-miR-1470	CLIP-seq
MIRT2591599	hsa-miR-1910	CLIP-seq
MIRT2591600	hsa-miR-2114	CLIP-seq
MIRT2591601	hsa-miR-3649	CLIP-seq
MIRT2591602	hsa-miR-455-3p	CLIP-seq
MIRT2591603	hsa-miR-4667-3p	CLIP-seq
MIRT2591604	hsa-miR-4711-5p	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20826455, 32296183
GO:0005777	Component	Peroxisome	IDA	20826455
GO:0005777	Component	Peroxisome	IEA
GO:0005778	Component	Peroxisomal membrane	IBA
GO:0005778	Component	Peroxisomal membrane	IDA	12559946
GO:0005778	Component	Peroxisomal membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016559	Process	Peroxisome fission	IBA
GO:0016559	Process	Peroxisome fission	IDA	20826455
GO:0016559	Process	Peroxisome fission	IEA
GO:0032991	Component	Protein-containing complex	IDA	20826455
GO:0044375	Process	Regulation of peroxisome size	IDA	20826455

MIM	HGNC	e!Ensembl
607583	20208	ENSG00000104883

Q96HA9

Protein name

Peroxisomal membrane protein 11C (Peroxin-11C) (Peroxisomal biogenesis factor 11C) (Protein PEX11 homolog gamma) (PEX11-gamma)

Protein function

Promotes membrane protrusion and elongation on the peroxisomal surface.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05648	PEX11	4 → 230	Peroxisomal biogenesis factor 11 (PEX11)	Family

Sequence

MASLSGLASALESYRGRDRLIRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCR
TILRLFDDLAMFVYTKQYGLGAQEEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHV
DSSRWWTLSTTLWALSLLLGVARSLWMLLKLRQRLRSPTAPFTSPLPRGKRRAMEAQMQS
EALSLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMYQAARAGGQAEATT
P

Sequence length

241

Interactions

View interactions

	KEGG
	Peroxisome

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PEROXISOME BIOGENESIS DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

PEX11G (peroxisomal biogenesis factor 11 gamma)