Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9293
Gene name Gene Name - the full gene name approved by the HGNC.	G protein-coupled receptor 52
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GPR52
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	Members of the G protein-coupled receptor (GPR) family play important roles in signal transduction from the external environment to the inside of the cell.[supplied by OMIM, Jul 2002]

Show/Hide all(4)

miRTarBase ID	miRNA	Experiments
MIRT1031506	hsa-miR-548aa	CLIP-seq
MIRT1031507	hsa-miR-640	CLIP-seq
MIRT2005981	hsa-miR-4659a-3p	CLIP-seq
MIRT2005982	hsa-miR-4659b-3p	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IDA	24587241
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	9931487
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9931487
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9931487
GO:0007602	Process	Phototransduction	IBA
GO:0007626	Process	Locomotory behavior	IEA
GO:0007626	Process	Locomotory behavior	ISS
GO:0008020	Function	G protein-coupled photoreceptor activity	IBA
GO:0009410	Process	Response to xenobiotic stimulus	IDA	24587241
GO:0009584	Process	Detection of visible light	IEA
GO:0016020	Component	Membrane	IEA
GO:0071482	Process	Cellular response to light stimulus	IBA

MIM	HGNC	e!Ensembl
604106	4508	ENSG00000203737

Protein

UniProt ID

Q9Y2T5

Protein name

G-protein coupled receptor 52

Protein function

Gs-coupled receptor activated by antipsychotics reserpine leading to an increase in intracellular cAMP and its internalization (PubMed:24587241). May play a role in locomotor activity through modulation of dopamine, NMDA and ADORA2A-induced loco

PDB

6LI0 , 6LI1 , 6LI2 , 6LI3 , 8HMP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	57 → 317	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, especially in striatum. {ECO:0000269|PubMed:24587241}.

Sequence

MNESRWTEWRILNMSSGIVNVSERHSCPLGFGHYSVVDVCIFETVVIVLLTFLIIAGNLT
VIFVFHCAPLLHHYTTSYFIQTMAYADLFVGVSCLVPTLSLLHYSTGVHESLTCQVFGYI
ISVLKSVSMACLACISVDRYLAITKPLSYNQLVTPCRLRICIILIWIYSCLIFLPSFFGW
GKPGYHGDIFEWCATSWLTSAYFTGFIVCLLYAPAAFVVCFTYFHIFKICRQHTKEINDR
RARFPSHEVDSSRETGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESSRVLDNPTLSF
LTTWLAISNSFCNCVIYSLSNSVFRLGLRRLSETMCTSCMCVKDQEAQEPKPRKRANSCS
I

Sequence length

361

Interactions

View interactions

GPR52 (G protein-coupled receptor 52)