Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	92912
Gene name	Ubiquitin conjugating enzyme E2 Q2
Gene symbol	UBE2Q2
Synonyms (NCBI Gene)	-
Chromosome	15
Chromosome location	15q24.2

139

Show/Hide all (139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028315	hsa-miR-32-5p	Sequencing	20371350
MIRT043371	hsa-miR-331-3p	CLASH	23622248
MIRT040557	hsa-miR-92b-3p	CLASH	23622248
MIRT073120	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT073117	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT073120	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT141279	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT141282	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT141280	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT141285	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT073116	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT073127	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT073118	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT073137	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT073117	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT1468580	hsa-miR-1227	CLIP-seq
MIRT1468581	hsa-miR-124	CLIP-seq
MIRT1468582	hsa-miR-1271	CLIP-seq
MIRT1468583	hsa-miR-182	CLIP-seq
MIRT1468584	hsa-miR-2113	CLIP-seq
MIRT1468585	hsa-miR-23a	CLIP-seq
MIRT1468586	hsa-miR-23b	CLIP-seq
MIRT1468587	hsa-miR-23c	CLIP-seq
MIRT1468588	hsa-miR-3169	CLIP-seq
MIRT1468589	hsa-miR-337-3p	CLIP-seq
MIRT1468590	hsa-miR-34b	CLIP-seq
MIRT1468591	hsa-miR-3685	CLIP-seq
MIRT1468592	hsa-miR-3714	CLIP-seq
MIRT1468593	hsa-miR-384	CLIP-seq
MIRT1468594	hsa-miR-3910	CLIP-seq
MIRT1468595	hsa-miR-4464	CLIP-seq
MIRT1468596	hsa-miR-4705	CLIP-seq
MIRT1468597	hsa-miR-4740-5p	CLIP-seq
MIRT1468598	hsa-miR-4748	CLIP-seq
MIRT1468599	hsa-miR-487a	CLIP-seq
MIRT1468600	hsa-miR-506	CLIP-seq
MIRT1468601	hsa-miR-520d-5p	CLIP-seq
MIRT1468602	hsa-miR-524-5p	CLIP-seq
MIRT1468603	hsa-miR-96	CLIP-seq
MIRT1468580	hsa-miR-1227	CLIP-seq
MIRT1468581	hsa-miR-124	CLIP-seq
MIRT1468604	hsa-miR-1245b-3p	CLIP-seq
MIRT1468605	hsa-miR-1273g	CLIP-seq
MIRT1468606	hsa-miR-1305	CLIP-seq
MIRT1468607	hsa-miR-132	CLIP-seq
MIRT1468608	hsa-miR-185	CLIP-seq
MIRT1468609	hsa-miR-186	CLIP-seq
MIRT1468610	hsa-miR-1911	CLIP-seq
MIRT1468584	hsa-miR-2113	CLIP-seq
MIRT1468611	hsa-miR-212	CLIP-seq
MIRT1468612	hsa-miR-299-5p	CLIP-seq
MIRT1468613	hsa-miR-3133	CLIP-seq
MIRT1468614	hsa-miR-3143	CLIP-seq
MIRT1468615	hsa-miR-3163	CLIP-seq
MIRT1468616	hsa-miR-3173-3p	CLIP-seq
MIRT1468617	hsa-miR-3200-3p	CLIP-seq
MIRT1468618	hsa-miR-3200-5p	CLIP-seq
MIRT1468590	hsa-miR-34b	CLIP-seq
MIRT1468619	hsa-miR-34c-3p	CLIP-seq
MIRT1468620	hsa-miR-3614-5p	CLIP-seq
MIRT1468621	hsa-miR-361-5p	CLIP-seq
MIRT1468622	hsa-miR-3662	CLIP-seq
MIRT1468623	hsa-miR-3668	CLIP-seq
MIRT1468624	hsa-miR-3677-5p	CLIP-seq
MIRT1468625	hsa-miR-3680	CLIP-seq
MIRT1468592	hsa-miR-3714	CLIP-seq
MIRT1468594	hsa-miR-3910	CLIP-seq
MIRT1468626	hsa-miR-4303	CLIP-seq
MIRT1468627	hsa-miR-4306	CLIP-seq
MIRT1468628	hsa-miR-4311	CLIP-seq
MIRT1468629	hsa-miR-4312	CLIP-seq
MIRT1468630	hsa-miR-4327	CLIP-seq
MIRT1468631	hsa-miR-4428	CLIP-seq
MIRT1468632	hsa-miR-4435	CLIP-seq
MIRT1468633	hsa-miR-4457	CLIP-seq
MIRT1468634	hsa-miR-4644	CLIP-seq
MIRT1468635	hsa-miR-4659a-5p	CLIP-seq
MIRT1468636	hsa-miR-4659b-5p	CLIP-seq
MIRT1468637	hsa-miR-4694-3p	CLIP-seq
MIRT1468596	hsa-miR-4705	CLIP-seq
MIRT1468638	hsa-miR-4709-5p	CLIP-seq
MIRT1468639	hsa-miR-4727-5p	CLIP-seq
MIRT1468640	hsa-miR-4776-3p	CLIP-seq
MIRT1468641	hsa-miR-4798-3p	CLIP-seq
MIRT1468642	hsa-miR-4803	CLIP-seq
MIRT1468643	hsa-miR-498	CLIP-seq
MIRT1468644	hsa-miR-505	CLIP-seq
MIRT1468600	hsa-miR-506	CLIP-seq
MIRT1468645	hsa-miR-513b	CLIP-seq
MIRT1468601	hsa-miR-520d-5p	CLIP-seq
MIRT1468602	hsa-miR-524-5p	CLIP-seq
MIRT1468646	hsa-miR-548ac	CLIP-seq
MIRT1468647	hsa-miR-548ae	CLIP-seq
MIRT1468648	hsa-miR-548aj	CLIP-seq
MIRT1468649	hsa-miR-548am	CLIP-seq
MIRT1468650	hsa-miR-548d-3p	CLIP-seq
MIRT1468651	hsa-miR-548x	CLIP-seq
MIRT1468652	hsa-miR-548z	CLIP-seq
MIRT1468653	hsa-miR-576-3p	CLIP-seq
MIRT1468654	hsa-miR-622	CLIP-seq
MIRT1468655	hsa-miR-627	CLIP-seq
MIRT1468656	hsa-miR-668	CLIP-seq
MIRT2140774	hsa-miR-2054	CLIP-seq
MIRT2140775	hsa-miR-3152-5p	CLIP-seq
MIRT1468625	hsa-miR-3680	CLIP-seq
MIRT2140776	hsa-miR-4328	CLIP-seq
MIRT2140777	hsa-miR-4422	CLIP-seq
MIRT2140778	hsa-miR-4718	CLIP-seq
MIRT2140779	hsa-miR-4774-3p	CLIP-seq
MIRT1468641	hsa-miR-4798-3p	CLIP-seq
MIRT2140780	hsa-miR-4798-5p	CLIP-seq
MIRT2140781	hsa-miR-582-5p	CLIP-seq
MIRT1468609	hsa-miR-186	CLIP-seq
MIRT1468581	hsa-miR-124	CLIP-seq
MIRT1468608	hsa-miR-185	CLIP-seq
MIRT1468610	hsa-miR-1911	CLIP-seq
MIRT1468615	hsa-miR-3163	CLIP-seq
MIRT1468617	hsa-miR-3200-3p	CLIP-seq
MIRT1468622	hsa-miR-3662	CLIP-seq
MIRT1468592	hsa-miR-3714	CLIP-seq
MIRT1468594	hsa-miR-3910	CLIP-seq
MIRT1468627	hsa-miR-4306	CLIP-seq
MIRT1468634	hsa-miR-4644	CLIP-seq
MIRT1468637	hsa-miR-4694-3p	CLIP-seq
MIRT1468600	hsa-miR-506	CLIP-seq
MIRT1468655	hsa-miR-627	CLIP-seq
MIRT1468581	hsa-miR-124	CLIP-seq
MIRT1468608	hsa-miR-185	CLIP-seq
MIRT1468610	hsa-miR-1911	CLIP-seq
MIRT1468615	hsa-miR-3163	CLIP-seq
MIRT1468617	hsa-miR-3200-3p	CLIP-seq
MIRT1468622	hsa-miR-3662	CLIP-seq
MIRT1468592	hsa-miR-3714	CLIP-seq
MIRT1468594	hsa-miR-3910	CLIP-seq
MIRT1468627	hsa-miR-4306	CLIP-seq
MIRT1468634	hsa-miR-4644	CLIP-seq
MIRT1468637	hsa-miR-4694-3p	CLIP-seq
MIRT1468600	hsa-miR-506	CLIP-seq
MIRT1468655	hsa-miR-627	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	20061386
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IBA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	IBA
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	20061386

MIM	HGNC	e!Ensembl
612501	19248	ENSG00000140367

Q8WVN8

Protein name

Ubiquitin-conjugating enzyme E2 Q2 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme Q2) (Ubiquitin carrier protein Q2) (Ubiquitin-protein ligase Q2)

Protein function

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination.

PDB

1ZUO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00179	UQ_con	208 → 363	Ubiquitin-conjugating enzyme	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in hypopharyngeal head and neck squamous cell carcinoma, in tumor masses and invasive epithelium. {ECO:0000269|PubMed:16300736}.

Sequence

MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNIT
ESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEM
LDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENL
AILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWH
VKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGG
GALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQ
IHEKNGWYTPPKEDG

Sequence length

375

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis		Synthesis of active ubiquitin: roles of E1 and E2 enzymes Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Congenital dyserythropoietic anemia	Uncertain significance	rs2505454298	RCV003326048

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	31171715
Colorectal Neoplasms	Associate	26745068
Renal Insufficiency Chronic	Associate	20383146, 21980298

UBE2Q2 (ubiquitin conjugating enzyme E2 Q2)