Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
92912
Gene name Gene Name - the full gene name approved by the HGNC.
Ubiquitin conjugating enzyme E2 Q2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
UBE2Q2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q24.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT028315 hsa-miR-32-5p Sequencing 20371350
MIRT043371 hsa-miR-331-3p CLASH 23622248
MIRT040557 hsa-miR-92b-3p CLASH 23622248
MIRT073120 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT073117 hsa-miR-20a-5p HITS-CLIP 22473208
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004842 Function Ubiquitin-protein transferase activity IDA 20061386
GO:0004842 Function Ubiquitin-protein transferase activity IEA
GO:0005515 Function Protein binding IPI 32814053
GO:0005524 Function ATP binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612501 19248 ENSG00000140367
Protein
UniProt ID Q8WVN8
Protein name Ubiquitin-conjugating enzyme E2 Q2 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme Q2) (Ubiquitin carrier protein Q2) (Ubiquitin-protein ligase Q2)
Protein function Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination.
PDB 1ZUO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00179 UQ_con 208 363 Ubiquitin-conjugating enzyme Domain
Tissue specificity TISSUE SPECIFICITY: Detected in hypopharyngeal head and neck squamous cell carcinoma, in tumor masses and invasive epithelium. {ECO:0000269|PubMed:16300736}.
Sequence
MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNIT
ESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEM
LDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENL
AILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWH
VKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGG
GALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQ
IHE
KNGWYTPPKEDG
Sequence length 375
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ubiquitin mediated proteolysis   Synthesis of active ubiquitin: roles of E1 and E2 enzymes
Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Gout Gout N/A N/A GWAS
Kidney Disease Chronic kidney disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 31171715
Colorectal Neoplasms Associate 26745068
Renal Insufficiency Chronic Associate 20383146, 21980298