Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
929
Gene name Gene Name - the full gene name approved by the HGNC.
CD14 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD14
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q31.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been id
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016817 hsa-miR-335-5p Microarray 18185580
Transcription factors
Transcription factor Regulation Reference
KLF4 Activation 17762869
MEF2D Activation 12213324
SP1 Activation 17203216
SP1 Unknown 11698458
SP2 Unknown 11698458
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001530 Function Lipopolysaccharide binding IBA
GO:0001530 Function Lipopolysaccharide binding IDA 12594207
GO:0001819 Process Positive regulation of cytokine production IBA
GO:0001819 Process Positive regulation of cytokine production IEA
GO:0001847 Function Opsonin receptor activity TAS 2402637
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
158120 1628 ENSG00000170458
Protein
UniProt ID P08571
Protein name Monocyte differentiation antigen CD14 (My23 antigen) (Myeloid cell-specific leucine-rich glycoprotein) (CD antigen CD14) [Cleaved into: Monocyte differentiation antigen CD14, urinary form; Monocyte differentiation antigen CD14, membrane-bound form]
Protein function Coreceptor for bacterial lipopolysaccharide (PubMed:1698311, PubMed:23264655). In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopol
PDB 4GLP
Family and domains
Tissue specificity TISSUE SPECIFICITY: Detected on macrophages (at protein level) (PubMed:1698311). Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages. {ECO:0000269|PubMed:1698311, ECO:0000269|
Sequence
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIH
AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE
LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA
Sequence length 375
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
NF-kappa B signaling pathway
Phagosome
Toll-like receptor signaling pathway
Hematopoietic cell lineage
Alcoholic liver disease
Shigellosis
Salmonella infection
Pertussis
Legionellosis
Amoebiasis
Tuberculosis
Transcriptional misregulation in cancer
Acute myeloid leukemia
Lipid and atherosclerosis
  ER-Phagosome pathway
Caspase activation via Death Receptors in the presence of ligand
Toll Like Receptor 4 (TLR4) Cascade
Transfer of LPS from LBP carrier to CD14
MyD88:MAL(TIRAP) cascade initiated on plasma membrane
MyD88-independent TLR4 cascade
Toll Like Receptor TLR1:TLR2 Cascade
Toll Like Receptor TLR6:TLR2 Cascade
TRIF-mediated programmed cell death
MyD88 deficiency (TLR2/4)
IRAK4 deficiency (TLR2/4)
Regulation of TLR by endogenous ligand
Neutrophil degranulation
Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon
IKK complex recruitment mediated by RIP1
TRAF6-mediated induction of TAK1 complex within TLR4 complex
IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Gout Gout N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abruptio Placentae Associate 16749413
Acquired Immunodeficiency Syndrome Associate 26475133, 9576185
Acquired Immunodeficiency Syndrome Inhibit 7527738
Acute Aortic Syndrome Stimulate 32509885
Acute Coronary Syndrome Stimulate 11132167, 25740391
Acute Coronary Syndrome Associate 39399429
Acute erythroleukemia Associate 18061959
Acute On Chronic Liver Failure Associate 28592438
Acute On Chronic Liver Failure Stimulate 34774066
Adenocarcinoma Associate 30413173