Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9275
Gene name Gene Name - the full gene name approved by the HGNC.
BAF chromatin remodeling complex subunit BCL7B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BCL7B
Synonyms (NCBI Gene) Gene synonyms aliases
SMARCJ2
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q11.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the BCL7 family including BCL7A, BCL7B and BCL7C proteins. This member is BCL7B, which contains a region that is highly similar to the N-terminal segment of BCL7A or BCL7C proteins. The BCL7A protein is encoded by the gene kn
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT046246 hsa-miR-23b-3p CLASH 23622248
MIRT038593 hsa-miR-106b-3p CLASH 23622248
MIRT462373 hsa-miR-320a PAR-CLIP 23592263
MIRT462372 hsa-miR-320b PAR-CLIP 23592263
MIRT462371 hsa-miR-320c PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding NAS 8605326
GO:0005515 Function Protein binding IPI 21044950, 25416956, 32296183
GO:0005575 Component Cellular_component ND
GO:0006915 Process Apoptotic process IEA
GO:0008150 Process Biological_process ND
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605846 1005 ENSG00000106635
Protein
UniProt ID Q9BQE9
Protein name B-cell CLL/lymphoma 7 protein family member B (allergen Hom s 3)
Protein function Positive regulator of apoptosis. Plays a role in the Wnt signaling pathway, negatively regulating the expression of Wnt signaling components CTNNB1 and HMGA1 (PubMed:25569233). Involved in cell cycle progression, maintenance of the nuclear struc
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04714 BCL_N 3 51 BCL7, N-terminal conserver region Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9860302, ECO:0000269|PubMed:9931421}.
Sequence
MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKS
KSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSES
LSPAHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDS
GAPPLKRFCVDQPTVPQTASES
Sequence length 202
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  ATP-dependent chromatin remodeling  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Metabolic Syndrome Metabolic Syndrome GWAS
Insomnia Insomnia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Alcoholism Associate 28981154
Astrocytoma Associate 18670637
Glioma Associate 34362400
Leiomyosarcoma Associate 34260555
Liposarcoma Associate 34260555
Metabolic Syndrome Associate 38201907
Neoplasms Associate 18670637, 34260555, 37648998
Sarcoma Associate 34260555
Stomach Neoplasms Associate 37648998