BCL7C (BAF chromatin remodeling complex subunit BCL7C)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9274
Gene name Gene Name - the full gene name approved by the HGNC.
BAF chromatin remodeling complex subunit BCL7C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BCL7C
Synonyms (NCBI Gene) Gene synonyms aliases
SMARCJ3
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of t
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT020663 hsa-miR-155-5p Proteomics 18668040
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
GO ID Ontology Definition Evidence Reference
GO:0006915 Process Apoptotic process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605847 1006 ENSG00000099385
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q8WUZ0
Protein name B-cell CLL/lymphoma 7 protein family member C
Protein function May play an anti-apoptotic role.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04714 BCL_N 3 → 51 BCL7, N-terminal conserver region Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9931421}.
Sequence 
MAGRTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERR
RAGGGAERSRGRERRGRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQ
PSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLTKEEPVPELLEAEAPEA
YPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPDP
Sequence length 217
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  ATP-dependent chromatin remodeling  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Ependymoma Ependymoma, Cellular Ependymoma rs1555165565, rs1555993293 26075792
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Anaplastic ependymoma Anaplastic Ependymoma 26075792 ClinVar
Psoriasis Psoriasis GWAS
Show/Hide Text Mining Associations (7)
Associations from Text Mining
Disease Name Relationship Type References
Alcoholism Associate 28981154
Carcinogenesis Associate 27039262
Glioma Associate 34362400
Neoplasms Inhibit 33306126
Ovarian Diseases Inhibit 33306126
Ovarian Neoplasms Inhibit 33306126
Sezary Syndrome Associate 27039262