BCL7C (BAF chromatin remodeling complex subunit BCL7C)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 9274
Gene name BAF chromatin remodeling complex subunit BCL7C
Gene symbol BCL7C
Synonyms (NCBI Gene)
SMARCJ3
Chromosome 16
Chromosome location 16p11.2
Summary This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of t
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT020663 hsa-miR-155-5p Proteomics 18668040
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (18)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin NAS 12192000, 29374058
GO:0005515 Function Protein binding IPI 33961781, 34819669
GO:0005654 Component Nucleoplasm TAS
GO:0006338 Process Chromatin remodeling NAS 10078207, 29374058
GO:0006357 Process Regulation of transcription by RNA polymerase II NAS 18809673, 29374058
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605847 1006 ENSG00000099385
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WUZ0
Protein name B-cell CLL/lymphoma 7 protein family member C
Protein function May play an anti-apoptotic role.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04714 BCL_N 3 → 51 BCL7, N-terminal conserver region Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9931421}.
Sequence 
MAGRTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERR
RAGGGAERSRGRERRGRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQ
PSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLTKEEPVPELLEAEAPEA
YPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPDP
Sequence length 217
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG 
  ATP-dependent chromatin remodeling  
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Squamous cell lung carcinoma - rs2543702787 RCV005932002
Show/Hide Text Mining Associations (7)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alcoholism Associate 28981154
Carcinogenesis Associate 27039262
Glioma Associate 34362400
Neoplasms Inhibit 33306126
Ovarian Diseases Inhibit 33306126
Ovarian Neoplasms Inhibit 33306126
Sezary Syndrome Associate 27039262