Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9274
Gene name Gene Name - the full gene name approved by the HGNC.
BAF chromatin remodeling complex subunit BCL7C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BCL7C
Synonyms (NCBI Gene) Gene synonyms aliases
SMARCJ3
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of t
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020663 hsa-miR-155-5p Proteomics 18668040
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin NAS 12192000, 29374058
GO:0005515 Function Protein binding IPI 33961781, 34819669
GO:0005654 Component Nucleoplasm TAS
GO:0006338 Process Chromatin remodeling NAS 10078207, 29374058
GO:0006357 Process Regulation of transcription by RNA polymerase II NAS 18809673, 29374058
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605847 1006 ENSG00000099385
Protein
UniProt ID Q8WUZ0
Protein name B-cell CLL/lymphoma 7 protein family member C
Protein function May play an anti-apoptotic role.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04714 BCL_N 3 51 BCL7, N-terminal conserver region Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9931421}.
Sequence
MAGRTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERR
RAGGGAERSRGRERRGRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQ
PSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLTKEEPVPELLEAEAPEA
YPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPDP
Sequence length 217
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  ATP-dependent chromatin remodeling  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alcoholism Associate 28981154
Carcinogenesis Associate 27039262
Glioma Associate 34362400
Neoplasms Inhibit 33306126
Ovarian Diseases Inhibit 33306126
Ovarian Neoplasms Inhibit 33306126
Sezary Syndrome Associate 27039262