DNER (delta/notch like EGF repeat containing)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
92737
Gene name Gene Name - the full gene name approved by the HGNC.
Delta/notch like EGF repeat containing
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DNER
Synonyms (NCBI Gene) Gene synonyms aliases
UNQ26, bet
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q36.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(19)
miRTarBase ID miRNA Experiments Reference
MIRT942226 hsa-miR-3692 CLIP-seq
MIRT942227 hsa-miR-548ad CLIP-seq
MIRT942228 hsa-miR-548c-3p CLIP-seq
MIRT1978961 hsa-miR-510 CLIP-seq
MIRT1978962 hsa-miR-512-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(23)
GO ID Ontology Definition Evidence Reference
GO:0001764 Process Neuron migration NAS 11950833
GO:0004888 Function Transmembrane signaling receptor activity TAS 11950833
GO:0005112 Function Notch binding IBA
GO:0005112 Function Notch binding IEA
GO:0005509 Function Calcium ion binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
607299 24456 ENSG00000187957
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8NFT8
Protein name Delta and Notch-like epidermal growth factor-related receptor
Protein function Activator of the NOTCH1 pathway. May mediate neuron-glia interaction during astrocytogenesis (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00008 EGF 98 → 131 EGF-like domain Domain
PF00008 EGF 353 → 388 EGF-like domain Domain
PF00008 EGF 396 → 426 EGF-like domain Domain
PF00008 EGF 434 → 464 EGF-like domain Domain
PF00008 EGF 472 → 501 EGF-like domain Domain
PF00008 EGF 509 → 539 EGF-like domain Domain
PF12661 hEGF 552 → 573 Human growth factor-like EGF Domain
PF00008 EGF 585 → 615 EGF-like domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, spinal cord and adrenal gland. {ECO:0000269|PubMed:11997712}.
Sequence 
MQPRRAQAPGAQLLPALALLLLLLGAGPRGSSLANPVPAAPLSAPGPCAAQPCRNGGVCT
SRPEPDPQHPAPAGEPGYSCTCPAGISGANCQLVADPCASNPCHHGNCSSSSSSSSDGYL
CICNEGYEGPNCEQALPSLPATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQP
KTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLW
KVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTL
VVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCEEYDACQRKPCQN
NASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPE
GYFGSACEEKVDPCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSPCAHG
TCRSVGTSYKCLCDPGYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHC
ELYKDPCANVSCLNGATCDSDGLNGTCICAPGFTGEECDIDINECDSNPCHHGGSCLDQP
NGYNCHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHSLYIIIGALCVAFILMLIILIVG
ICRISRIEYQGSSRPAYEEFYNCRSIDSEFSNAIASIRHARFGKKSRPAMYDVSPIAYED
YSPDDKPLVTLIKTKDL
Sequence length 737
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Carpal Tunnel Syndrome Carpal tunnel syndrome N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Show/Hide Text Mining Associations (83)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 23129625
Arthritis Rheumatoid Associate 37108786
Asthma Associate 25713319
Astrocytoma Associate 32240793
Ataxia Associate 35940913
Atherosclerosis Associate 26868508
Autism Spectrum Disorder Associate 32393163
Autoimmune Diseases Associate 26387944
Behcet Syndrome Associate 32811806
Breast Neoplasms Associate 25721606, 25865888, 28055972, 31551256, 32811806, 35881485, 37968653