DNER (delta/notch like EGF repeat containing)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 92737
Gene name Delta/notch like EGF repeat containing
Gene symbol DNER
Synonyms (NCBI Gene)
UNQ26bet
Chromosome 2
Chromosome location 2q36.3
miRNA miRNA information provided by mirtarbase database.
19
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (19)
miRTarBase ID miRNA Experiments Reference
MIRT942226 hsa-miR-3692 CLIP-seq
MIRT942227 hsa-miR-548ad CLIP-seq
MIRT942228 hsa-miR-548c-3p CLIP-seq
MIRT1978961 hsa-miR-510 CLIP-seq
MIRT1978962 hsa-miR-512-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (23)
GO ID Ontology Definition Evidence Reference
GO:0001764 Process Neuron migration NAS 11950833
GO:0004888 Function Transmembrane signaling receptor activity TAS 11950833
GO:0005112 Function Notch binding IBA
GO:0005112 Function Notch binding IEA
GO:0005509 Function Calcium ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
607299 24456 ENSG00000187957
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NFT8
Protein name Delta and Notch-like epidermal growth factor-related receptor
Protein function Activator of the NOTCH1 pathway. May mediate neuron-glia interaction during astrocytogenesis (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00008 EGF 98 → 131 EGF-like domain Domain
PF00008 EGF 353 → 388 EGF-like domain Domain
PF00008 EGF 396 → 426 EGF-like domain Domain
PF00008 EGF 434 → 464 EGF-like domain Domain
PF00008 EGF 472 → 501 EGF-like domain Domain
PF00008 EGF 509 → 539 EGF-like domain Domain
PF12661 hEGF 552 → 573 Human growth factor-like EGF Domain
PF00008 EGF 585 → 615 EGF-like domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, spinal cord and adrenal gland. {ECO:0000269|PubMed:11997712}.
Sequence 
MQPRRAQAPGAQLLPALALLLLLLGAGPRGSSLANPVPAAPLSAPGPCAAQPCRNGGVCT
SRPEPDPQHPAPAGEPGYSCTCPAGISGANCQLVADPCASNPCHHGNCSSSSSSSSDGYL
CICNEGYEGPNCEQALPSLPATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQP
KTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLW
KVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTL
VVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCEEYDACQRKPCQN
NASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPE
GYFGSACEEKVDPCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSPCAHG
TCRSVGTSYKCLCDPGYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHC
ELYKDPCANVSCLNGATCDSDGLNGTCICAPGFTGEECDIDINECDSNPCHHGGSCLDQP
NGYNCHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHSLYIIIGALCVAFILMLIILIVG
ICRISRIEYQGSSRPAYEEFYNCRSIDSEFSNAIASIRHARFGKKSRPAMYDVSPIAYED
YSPDDKPLVTLIKTKDL
Sequence length 737
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Malignant tumor of urinary bladder Benign rs147002066 RCV005903061
Show/Hide Text Mining Associations (83)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 23129625
Arthritis Rheumatoid Associate 37108786
Asthma Associate 25713319
Astrocytoma Associate 32240793
Ataxia Associate 35940913
Atherosclerosis Associate 26868508
Autism Spectrum Disorder Associate 32393163
Autoimmune Diseases Associate 26387944
Behcet Syndrome Associate 32811806
Breast Neoplasms Associate 25721606, 25865888, 28055972, 31551256, 32811806, 35881485, 37968653