ARRDC1 (arrestin domain containing 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
92714
Gene name Gene Name - the full gene name approved by the HGNC.
Arrestin domain containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ARRDC1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q34.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(11)
miRTarBase ID miRNA Experiments Reference
MIRT043649 hsa-miR-326 CLASH 23622248
MIRT800644 hsa-miR-1915 CLIP-seq
MIRT800645 hsa-miR-2467-3p CLIP-seq
MIRT800646 hsa-miR-3178 CLIP-seq
MIRT800647 hsa-miR-4436b-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(23)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 22315426, 23236378, 23886940, 27462458, 28514442, 32296183, 33961781, 38270169
GO:0005737 Component Cytoplasm IBA
GO:0005886 Component Plasma membrane IDA 22315426, 23236378, 27462458
GO:0005886 Component Plasma membrane IEA
GO:0006511 Process Ubiquitin-dependent protein catabolic process IMP 27462458
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
619768 28633 ENSG00000197070
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8N5I2
Protein name Arrestin domain-containing protein 1 (Alpha-arrestin 1)
Protein function Functions as an adapter recruiting ubiquitin-protein ligases to their specific substrates (PubMed:23886940, PubMed:27462458). Through an ubiquitination-dependent mechanism plays for instance a role in the incorporation of SLC11A2 into extracellu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00339 Arrestin_N 7 → 139 Arrestin (or S-antigen), N-terminal domain Domain
PF02752 Arrestin_C 162 → 286 Arrestin (or S-antigen), C-terminal domain Domain
Sequence 
MGRVQLFEISLSHGRVVYSPGEPLAGTVRVRLGAPLPFRAIRVTCIGSCGVSNKANDTAW
VVEEGYFNSSLSLADKGSLPAGEHSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRF
SKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVG
QALQLHADVENQSGKDTSPVVASLLQKVSYKAKRWIHDVRTIAEVEGAGVKAWRRAQWHE
QILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVFIGNIAVNHAPVSPRPGLGLP
PGAPPLVVPSAPPQEEAEAEAAAGGPHFLDPVFLSTKSHSQRQPLLATLSSVPGAPEPCP
QDGSPASHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYSSWGYPYEAPPSYEQ
SCGGVEPSLTPES
Sequence length 433
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (childhood onset), Atopic asthma, Asthma (age of onset), Asthma, Age of onset of childhood onset asthma N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Eczema Eczema N/A N/A GWAS
Show/Hide Text Mining Associations (3)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 26942882
Carcinoma Hepatocellular Associate 35300565
Neoplasm Metastasis Associate 35300565