Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9267
Gene name Gene Name - the full gene name approved by the HGNC.	Cytohesin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CYTH1
Synonyms (NCBI Gene) Gene synonyms aliases	B2-1, CYTOHESIN-1, D17S811E, PSCD1, SEC7
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The c

Show/Hide all(97)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016372	hsa-miR-193b-3p	Microarray	20304954
MIRT017284	hsa-miR-335-5p	Microarray	18185580
MIRT029189	hsa-miR-26b-5p	Microarray	19088304
MIRT047342	hsa-miR-34a-5p	CLASH	23622248
MIRT486034	hsa-miR-3940-3p	PAR-CLIP	23592263
MIRT486033	hsa-miR-1827	PAR-CLIP	23592263
MIRT486034	hsa-miR-3940-3p	PAR-CLIP	23592263
MIRT486033	hsa-miR-1827	PAR-CLIP	23592263
MIRT922098	hsa-miR-1253	CLIP-seq
MIRT922099	hsa-miR-1266	CLIP-seq
MIRT922100	hsa-miR-2278	CLIP-seq
MIRT922101	hsa-miR-28-5p	CLIP-seq
MIRT922102	hsa-miR-3127-5p	CLIP-seq
MIRT922103	hsa-miR-3130-3p	CLIP-seq
MIRT922104	hsa-miR-3139	CLIP-seq
MIRT922105	hsa-miR-3173-5p	CLIP-seq
MIRT922106	hsa-miR-3918	CLIP-seq
MIRT922107	hsa-miR-4271	CLIP-seq
MIRT922108	hsa-miR-4434	CLIP-seq
MIRT922109	hsa-miR-4446-3p	CLIP-seq
MIRT922110	hsa-miR-4466	CLIP-seq
MIRT922111	hsa-miR-4516	CLIP-seq
MIRT922112	hsa-miR-4518	CLIP-seq
MIRT922113	hsa-miR-4722-5p	CLIP-seq
MIRT922114	hsa-miR-4725-3p	CLIP-seq
MIRT922115	hsa-miR-542-5p	CLIP-seq
MIRT922116	hsa-miR-604	CLIP-seq
MIRT922117	hsa-miR-638	CLIP-seq
MIRT922118	hsa-miR-675	CLIP-seq
MIRT922119	hsa-miR-708	CLIP-seq
MIRT922120	hsa-miR-193a-3p	CLIP-seq
MIRT922121	hsa-miR-193b	CLIP-seq
MIRT922122	hsa-miR-3125	CLIP-seq
MIRT922123	hsa-miR-3916	CLIP-seq
MIRT922124	hsa-miR-3919	CLIP-seq
MIRT922125	hsa-miR-4435	CLIP-seq
MIRT922126	hsa-miR-4459	CLIP-seq
MIRT922127	hsa-miR-4468	CLIP-seq
MIRT922128	hsa-miR-4476	CLIP-seq
MIRT922129	hsa-miR-4641	CLIP-seq
MIRT922130	hsa-miR-4695-5p	CLIP-seq
MIRT922131	hsa-miR-4738-3p	CLIP-seq
MIRT922132	hsa-miR-485-5p	CLIP-seq
MIRT922133	hsa-miR-516b	CLIP-seq
MIRT922134	hsa-miR-665	CLIP-seq
MIRT922135	hsa-miR-760	CLIP-seq
MIRT1973123	hsa-miR-1252	CLIP-seq
MIRT1973124	hsa-miR-1254	CLIP-seq
MIRT922099	hsa-miR-1266	CLIP-seq
MIRT1973125	hsa-miR-1288	CLIP-seq
MIRT1973126	hsa-miR-1291	CLIP-seq
MIRT1973127	hsa-miR-3116	CLIP-seq
MIRT922102	hsa-miR-3127-5p	CLIP-seq
MIRT1973128	hsa-miR-3173-3p	CLIP-seq
MIRT1973129	hsa-miR-3194-3p	CLIP-seq
MIRT1973130	hsa-miR-3690	CLIP-seq
MIRT922106	hsa-miR-3918	CLIP-seq
MIRT1973131	hsa-miR-4268	CLIP-seq
MIRT1973132	hsa-miR-4320	CLIP-seq
MIRT922109	hsa-miR-4446-3p	CLIP-seq
MIRT922112	hsa-miR-4518	CLIP-seq
MIRT1973133	hsa-miR-4640-5p	CLIP-seq
MIRT1973134	hsa-miR-4691-5p	CLIP-seq
MIRT1973135	hsa-miR-4726-5p	CLIP-seq
MIRT1973124	hsa-miR-1254	CLIP-seq
MIRT1973127	hsa-miR-3116	CLIP-seq
MIRT1973130	hsa-miR-3690	CLIP-seq
MIRT2386681	hsa-miR-4515	CLIP-seq
MIRT2512593	hsa-miR-1207-3p	CLIP-seq
MIRT2512594	hsa-miR-146a	CLIP-seq
MIRT2512595	hsa-miR-146b-5p	CLIP-seq
MIRT2512596	hsa-miR-1538	CLIP-seq
MIRT2512597	hsa-miR-1972	CLIP-seq
MIRT2512598	hsa-miR-3065-3p	CLIP-seq
MIRT2512599	hsa-miR-3120-5p	CLIP-seq
MIRT2512600	hsa-miR-3155	CLIP-seq
MIRT2512601	hsa-miR-3155b	CLIP-seq
MIRT2512602	hsa-miR-3183	CLIP-seq
MIRT2512603	hsa-miR-338-3p	CLIP-seq
MIRT922106	hsa-miR-3918	CLIP-seq
MIRT2512604	hsa-miR-4261	CLIP-seq
MIRT2512605	hsa-miR-4438	CLIP-seq
MIRT2512606	hsa-miR-4496	CLIP-seq
MIRT2512607	hsa-miR-4520a-3p	CLIP-seq
MIRT2512608	hsa-miR-4530	CLIP-seq
MIRT2512609	hsa-miR-4638-3p	CLIP-seq
MIRT1973133	hsa-miR-4640-5p	CLIP-seq
MIRT2512610	hsa-miR-4685-5p	CLIP-seq
MIRT2512611	hsa-miR-4723-3p	CLIP-seq
MIRT2512612	hsa-miR-4726-3p	CLIP-seq
MIRT1973135	hsa-miR-4726-5p	CLIP-seq
MIRT2512613	hsa-miR-4745-3p	CLIP-seq
MIRT2512614	hsa-miR-484	CLIP-seq
MIRT2512615	hsa-miR-580	CLIP-seq
MIRT2512616	hsa-miR-589	CLIP-seq
MIRT2512617	hsa-miR-764	CLIP-seq
MIRT2512618	hsa-miR-766	CLIP-seq

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	10652308
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS	9050849
GO:0005515	Function	Protein binding	IPI	11867758, 28514442, 29420262, 31022698, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IDA	12606567
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	12606567, 17398095
GO:0005886	Component	Plasma membrane	IEA
GO:0005912	Component	Adherens junction	IEA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005923	Component	Bicellular tight junction	ISS
GO:0008289	Function	Lipid binding	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	TAS	1511013
GO:0030155	Process	Regulation of cell adhesion	IDA	12606567
GO:0032012	Process	Regulation of ARF protein signal transduction	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0090162	Process	Establishment of epithelial cell polarity	ISS

MIM	HGNC	e!Ensembl
182115	9501	ENSG00000108669

Protein

UniProt ID

Q15438

Protein name

Cytohesin-1 (PH, SEC7 and coiled-coil domain-containing protein 1) (SEC7 homolog B2-1)

Protein function

Promotes guanine-nucleotide exchange on ARF1, ARF5 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. Plays an important role in membrane trafficking, during junctional remodeling and epithelial polarization, t

PDB

1BC9 , 4A4P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01369	Sec7	62 → 244	Sec7 domain	Domain
PF00169	PH	261 → 377	PH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNM
QRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD
EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVF
QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIK
NEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKE
PRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAP
TPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH

Sequence length

398

Interactions

View interactions

	KEGG		Reactome
	Phospholipase D signaling pathway Endocytosis Pathogenic Escherichia coli infection Shigellosis Salmonella infection		Intra-Golgi traffic

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Connective Tissue Diseases	Associate	22208759
Genetic Diseases Inborn	Associate	22208759
Heredodegenerative Disorders Nervous System	Associate	22208759
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	27713165
Lymphoma Large Cell Anaplastic	Associate	12181047
Myotonia with Skeletal Abnormalities and Mental Retardation	Associate	22208759
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	33408168
Prostatic Neoplasms	Associate	21670894

CYTH1 (cytohesin 1)