Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
92609
Gene name Gene Name - the full gene name approved by the HGNC.
Translocase of inner mitochondrial membrane 50
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TIMM50
Synonyms (NCBI Gene) Gene synonyms aliases
MGCA9, TIM50, TIM50L
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MGCA9
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a subunit of the TIM23 inner mitochondrial membrane translocase complex. The encoded protein functions as the receptor subunit that recognizes the mitochondrial targeting signal, or presequence, on protein cargo that is destined for the
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs35135520 C>A,G,T Benign, pathogenic Coding sequence variant, stop gained, missense variant, upstream transcript variant, genic upstream transcript variant, 5 prime UTR variant
rs776019250 G>C,T Pathogenic Missense variant, 5 prime UTR variant, coding sequence variant
rs797044891 G>A Pathogenic Missense variant, coding sequence variant
rs1244226820 C>T Pathogenic Coding sequence variant, missense variant
rs1300848445 C>T Pathogenic Intron variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016403 hsa-miR-193b-3p Proteomics 21512034
MIRT025669 hsa-miR-7-5p Microarray 19073608
MIRT052037 hsa-let-7b-5p CLASH 23622248
MIRT051530 hsa-let-7e-5p CLASH 23622248
MIRT046584 hsa-miR-222-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001836 Process Release of cytochrome c from mitochondria IDA 15044455
GO:0003723 Function RNA binding IEA
GO:0004721 Function Phosphoprotein phosphatase activity IBA 21873635
GO:0004721 Function Phosphoprotein phosphatase activity IDA 15044455
GO:0004722 Function Protein serine/threonine phosphatase activity IDA 15044455
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607381 23656 ENSG00000105197
Protein
UniProt ID Q3ZCQ8
Protein name Mitochondrial import inner membrane translocase subunit TIM50
Protein function Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane (PubMed:30190335, PubMed:38828998). Has some phosphatase activity in vitro; howeve
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03031 NIF 148 295 NLI interacting factor-like phosphatase Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at higher level in brain, kidney and liver (at protein level). {ECO:0000269|PubMed:15044455, ECO:0000269|PubMed:16008839}.
Sequence
MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGP
SYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFK
DYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETL
FQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRD
PARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVR
TVLEH
YALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP
Sequence length 353
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
3-methylglutaconic aciduria 3-METHYLGLUTACONIC ACIDURIA, TYPE IX rs137854888, rs80356523, rs80356526, rs121434636, rs730880309, rs730880310, rs730880311, rs730880312, rs199474657, rs1603377590, rs104894941, rs2147483647, rs132630277, rs1603377747, rs1603376833
View all (64 more)
27573165, 31058414
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Epileptic encephalopathy Encephalopathies rs587776508, rs121918334, rs121918317, rs121918321, rs74315390, rs28939684, rs74315391, rs74315392, rs118192244, rs121918622, rs121918623, rs121917953, rs121917955, rs121918624, rs121918625
View all (860 more)
Infantile spasms Infantile Spasm rs387906686, rs1553579488, rs1553567561
Unknown
Disease term Disease name Evidence References Source
3-Methylglutaconic aciduria 3-methylglutaconic aciduria type 9 GenCC
Associations from Text Mining
Disease Name Relationship Type References
3 Methylglutaconic Aciduria Associate 27573165
Brain Diseases Associate 30190335
Breast Neoplasms Stimulate 21621504
Breast Neoplasms Associate 26289846
Developmental Disabilities Associate 27573165, 35019165
Endometrial Neoplasms Associate 37259038
Epilepsy Associate 27573165
Esophageal Neoplasms Associate 32130753
Intellectual Disability Associate 27573165, 35019165
Leigh Syndrome due to Mitochondrial Complex V Deficiency Associate 27573165