PDLIM7 (PDZ and LIM domain 7)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9260
Gene name Gene Name - the full gene name approved by the HGNC.
PDZ and LIM domain 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PDLIM7
Synonyms (NCBI Gene) Gene synonyms aliases
LMP1, LMP3
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q35.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is representative of a family of proteins composed of conserved PDZ and LIM domains. LIM domains are proposed to function in protein-protein recognition in a variety of contexts including gene transcription and development
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(75)
miRTarBase ID miRNA Experiments Reference
MIRT001351 hsa-miR-1-3p pSILAC 18668040
MIRT006185 ebv-miR-BHRF1-2-3p Immunoprecipitaion, qRT-PCR, Western blot 21379335
MIRT006185 ebv-miR-BHRF1-2-3p Immunoprecipitaion, qRT-PCR, Western blot 21379335
MIRT006185 ebv-miR-BHRF1-2-3p Immunoprecipitaion, qRT-PCR, Western blot 21379335
MIRT002914 hsa-miR-124-3p Proteomics;Microarray 18668037
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
IRF5 Repression 16140744
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(21)
GO ID Ontology Definition Evidence Reference
GO:0001503 Process Ossification IEA
GO:0001725 Component Stress fiber IBA 21873635
GO:0001726 Component Ruffle IEA
GO:0003779 Function Actin binding IBA 21873635
GO:0005515 Function Protein binding IPI 16189514, 16713569, 23088713, 25036637, 25416956, 28514442, 29892012, 31515488, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605903 22958 ENSG00000196923
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9NR12
Protein name PDZ and LIM domain protein 7 (LIM mineralization protein) (LMP) (Protein enigma)
Protein function May function as a scaffold on which the coordinated assembly of proteins can occur. May play a role as an adapter that, via its PDZ domain, localizes LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Involved
PDB 2Q3G , 7RM8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00595 PDZ 3 → 82 PDZ domain Domain
PF00412 LIM 282 → 337 LIM domain Domain
PF00412 LIM 341 → 396 LIM domain Domain
PF00412 LIM 400 → 457 LIM domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed ubiquitously, however, isoform 2 predominates in skeletal muscle, isoform 1 is more abundant in lung, spleen, leukocytes and fetal liver. {ECO:0000269|PubMed:11874232}.
Sequence 
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGS
LTHIEAQNKIRACGERLSLGLSRAQPVQSKPQKASAPAADPPRYTFAPSVSLNKTARPFG
APPPADSAPQQNGQPLRPLVPDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFMQ
DPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTS
TVLTRHSQPATPTPLQSRTSIVQAAAGGVPGGGSNNGKTPVCHQCHKVIRGRYLVALGHA
YHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTW
HVHCFTCAACKTPIRNRAFYMEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFS
WHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSHV
Sequence length 457
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytoskeleton in muscle cells   RET signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Mitral Valve Prolapse mitral valve prolapse GenCC
Rett Syndrome atypical Rett syndrome GenCC
Show/Hide Text Mining Associations (70)
Associations from Text Mining
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 7605982, 8214003, 8562956, 9006332
AIDS Associated Nephropathy Associate 10090942
Ataxia Telangiectasia Associate 8638607
Bone Marrow Diseases Stimulate 20052729
Burkitt Lymphoma Associate 11162833, 12907442, 1647016, 20052729, 2170681, 21853056, 22345482, 2470924, 24829410, 2542588, 26244812, 2668563, 2828684, 3037521, 40367275
View all (4 more)
Burkitt Lymphoma Inhibit 1313894
Carcinogenesis Associate 15254213, 16840319, 19656130, 21795333, 24814906, 25520502, 25958199, 31266997, 33577806
Carcinogenesis Stimulate 17148591, 23496845, 33423158, 35458531
Carcinoma Associate 18275617, 22761726
Carcinoma Embryonal Associate 9420627