Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9254
Gene name Gene Name - the full gene name approved by the HGNC.
Calcium voltage-gated channel auxiliary subunit alpha2delta 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CACNA2D2
Synonyms (NCBI Gene) Gene synonyms aliases
CACNA2D, CASVDD
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p21.31
Summary Summary of gene provided in NCBI Entrez Gene.
Calcium channels mediate the entry of calcium ions into the cell upon membrane polarization. This gene encodes the alpha-2/delta subunit of the voltage-dependent calcium channel complex. The complex consists of the main channel-forming subunit alpha-1, an
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs587777165 T>- Pathogenic Coding sequence variant, frameshift variant
rs1057518420 C>T Likely-pathogenic Splice acceptor variant
rs1060503108 TA>- Pathogenic Stop gained, coding sequence variant
rs1211603072 G>A Pathogenic, uncertain-significance Coding sequence variant, missense variant
rs1485894376 C>G,T Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT453381 hsa-miR-4484 PAR-CLIP 23592263
MIRT453380 hsa-miR-4779 PAR-CLIP 23592263
MIRT453379 hsa-miR-4459 PAR-CLIP 23592263
MIRT453378 hsa-miR-6804-5p PAR-CLIP 23592263
MIRT453377 hsa-miR-4668-5p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005245 Function Voltage-gated calcium channel activity IBA
GO:0005245 Function Voltage-gated calcium channel activity IEA
GO:0005262 Function Calcium channel activity IEA
GO:0005886 Component Plasma membrane TAS
GO:0005891 Component Voltage-gated calcium channel complex IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607082 1400 ENSG00000007402
Protein
UniProt ID Q9NY47
Protein name Voltage-dependent calcium channel subunit alpha-2/delta-2 (Voltage-gated calcium channel subunit alpha-2/delta-2) [Cleaved into: Voltage-dependent calcium channel subunit alpha-2-2; Voltage-dependent calcium channel subunit delta-2]
Protein function The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Acts as a regulatory subunit for P/Q-type calcium channel (CACNA1A), N-type (CACNA1B),
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08399 VWA_N 141 265 VWA N-terminal Family
PF00092 VWA 291 464 von Willebrand factor type A domain Domain
PF08473 VGCC_alpha2 669 1111 Neuronal voltage-dependent calcium channel alpha 2acd Family
Tissue specificity TISSUE SPECIFICITY: Predominantly present in cerebellar cortex. Present in various lung tumor cell lines, while it is absent in normal lung (at protein level). Highly expressed in heart, lung, testis, pancreas and skeletal muscle. Also expressed in kidney
Sequence
MAVPARTCGASRPGPARTARPWPGCGPHPGPGTRRPTSGPPRPLWLLLPLLPLLAAPGAS
AYSFPQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVA
GDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVER
GSKASTLRLDFIEDPNFKNKVNYSYAAVQIPTDIYKGSTVILNELNWTEALENVFMENRR
QDPTLLWQVFGSATGVTRYYPATPW
RAPKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSG
SVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFKEAV
QGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNRT
VRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQE
YLDVLGRPMVLAGKEA
KQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPN
YTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMIDGN
KGHKQIRTLVKSLDERYIDEVTRNYTWVPIRSTNYSLGLVLPPYSTFYLQANLSDQILQV
KLPISKLKDFEFLLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSK
QCNNFLLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAAEDWTE
NPEPFNASFYRRSLDNHGYVFKPPHQDALLRPLELENDTVGILVSTAVELSLGRRTLRPA
VVGVKLDLEAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLV
LSNQNHQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAPRGVF
VPTVADFLNLAWWTSAAAWSLFQQLLYGLIYHSWFQADPAEAEGSPETRESSCVMKQTQY
YFGSVNASYNAIIDCGNCSRLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHSDGP
EQCELVQRPRYRRGPHICFDYNATEDTSDCG
RGASFPPSLGVLVSLQLLLLLGLPPRPQP
QVLVHASRRL
Sequence length 1150
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy
  Presynaptic depolarization and calcium channel opening
Regulation of insulin secretion
Phase 0 - rapid depolarisation
Phase 2 - plateau phase
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Epileptic Encephalopathy early infantile epileptic encephalopathy with suppression bursts rs749539763, rs1060503108, rs1559884460, rs1559887808, rs1575603683, rs1575601202, rs1704944478 N/A
Epileptic encephalopathy epileptic encephalopathy rs1485894376 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bipolar Disorder Bipolar I disorder N/A N/A GWAS
Cerebellar atrophy cerebellar atrophy with seizures and variable developmental delay N/A N/A GenCC
Insomnia Insomnia N/A N/A GWAS
Neurodevelopmental Disorders complex neurodevelopmental disorder N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Ataxia Associate 31402629
Brain Diseases Associate 24358150, 29997391, 31402629
Breast Neoplasms Associate 22139571
Breast Neoplasms Inhibit 33742056
Carcinoma Non Small Cell Lung Associate 23237220
Cerebellar Diseases Associate 31402629
Endometrial Neoplasms Associate 32074080, 37352078
Epilepsy Absence Associate 20561025
Epileptic Encephalopathy Early Infantile 3 Associate 31402629
Frontotemporal Lobar Degeneration Associate 40158290