Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	925
Gene name Gene Name - the full gene name approved by the HGNC.	CD8 subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CD8A
Synonyms (NCBI Gene) Gene synonyms aliases	CD8, CD8alpha, IMD116, Leu2, p32
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p11.2
Summary Summary of gene provided in NCBI Entrez Gene.	The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize an

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121918660	C>T	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant

Show/Hide all(40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007284	hsa-miR-196b-5p	Luciferase reporter assay	23359619
MIRT016928	hsa-miR-335-5p	Microarray	18185580
MIRT876396	hsa-miR-140-5p	CLIP-seq
MIRT876397	hsa-miR-2116	CLIP-seq
MIRT876398	hsa-miR-3617	CLIP-seq
MIRT876399	hsa-miR-4481	CLIP-seq
MIRT876400	hsa-miR-4745-5p	CLIP-seq
MIRT876401	hsa-miR-4758-5p	CLIP-seq
MIRT876402	hsa-miR-641	CLIP-seq
MIRT876403	hsa-miR-4527	CLIP-seq
MIRT1959724	hsa-miR-371b-5p	CLIP-seq
MIRT2196776	hsa-miR-1273e	CLIP-seq
MIRT2196777	hsa-miR-4503	CLIP-seq
MIRT876403	hsa-miR-4527	CLIP-seq
MIRT738188	hsa-miR-1285	CLIP-seq
MIRT2446627	hsa-miR-144	CLIP-seq
MIRT2446628	hsa-miR-2467-5p	CLIP-seq
MIRT738189	hsa-miR-3187-5p	CLIP-seq
MIRT738192	hsa-miR-326	CLIP-seq
MIRT738193	hsa-miR-330-5p	CLIP-seq
MIRT738187	hsa-miR-378g	CLIP-seq
MIRT738191	hsa-miR-4486	CLIP-seq
MIRT738190	hsa-miR-612	CLIP-seq
MIRT2446629	hsa-miR-760	CLIP-seq
MIRT2499916	hsa-miR-1270	CLIP-seq
MIRT2499917	hsa-miR-204	CLIP-seq
MIRT2499918	hsa-miR-211	CLIP-seq
MIRT2499919	hsa-miR-4531	CLIP-seq
MIRT2499920	hsa-miR-4755-5p	CLIP-seq
MIRT2499921	hsa-miR-4780	CLIP-seq
MIRT2499922	hsa-miR-620	CLIP-seq
MIRT2499923	hsa-miR-623	CLIP-seq
MIRT2499916	hsa-miR-1270	CLIP-seq
MIRT2499917	hsa-miR-204	CLIP-seq
MIRT2499918	hsa-miR-211	CLIP-seq
MIRT2499919	hsa-miR-4531	CLIP-seq
MIRT2499920	hsa-miR-4755-5p	CLIP-seq
MIRT2499921	hsa-miR-4780	CLIP-seq
MIRT2499922	hsa-miR-620	CLIP-seq
MIRT2499923	hsa-miR-623	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
ETS1	Activation	8413295
GATA3	Activation	8413295

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	NAS	17145893, 22081144
GO:0002376	Process	Immune system process	IEA
GO:0002456	Process	T cell mediated immunity	IBA
GO:0005515	Function	Protein binding	IPI	2470098, 2493728, 9177355, 12853576
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IDA	2784196
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISO
GO:0005886	Component	Plasma membrane	NAS	2496167
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	NAS	11131152
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	NAS	9830036
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	17213291
GO:0009897	Component	External side of plasma membrane	IEA
GO:0015026	Function	Coreceptor activity	NAS	11131152
GO:0016020	Component	Membrane	IEA
GO:0019882	Process	Antigen processing and presentation	NAS	2496167
GO:0023024	Function	MHC class I protein complex binding	IDA	2784196, 9177355
GO:0042101	Component	T cell receptor complex	NAS	11131152
GO:0042110	Process	T cell activation	IDA	17145893
GO:0042110	Process	T cell activation	IEA
GO:0042110	Process	T cell activation	ISS
GO:0042110	Process	T cell activation	NAS	9830036
GO:0042288	Function	MHC class I protein binding	NAS	11131152
GO:0043235	Component	Receptor complex	IEA
GO:0043235	Component	Receptor complex	IPI	17243170
GO:0043235	Component	Receptor complex	ISO
GO:0044853	Component	Plasma membrane raft	IDA	17341584
GO:0045065	Process	Cytotoxic T cell differentiation	IBA
GO:0050852	Process	T cell receptor signaling pathway	IDA	17145893
GO:0050852	Process	T cell receptor signaling pathway	ISS

MIM	HGNC	e!Ensembl
186910	1706	ENSG00000153563

Protein

UniProt ID

P01732

Protein name

T-cell surface glycoprotein CD8 alpha chain (T-lymphocyte differentiation antigen T8/Leu-2) (CD antigen CD8a)

Protein function

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:p

PDB

1AKJ , 1CD8 , 1Q69 , 2HP4 , 3QZW , 7UMG , 7UVF , 8EW6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	26 → 133	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphoc

Sequence

MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN
SIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA
CDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV

Sequence length

235

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules Antigen processing and presentation Hematopoietic cell lineage T cell receptor signaling pathway Yersinia infection Primary immunodeficiency		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

CD8A (CD8 subunit alpha)