CD8A (CD8 subunit alpha)

Gene
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
925
Gene name Gene Name - the full gene name approved by the HGNC.
CD8 subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD8A
Synonyms (NCBI Gene) Gene synonyms aliases
CD8, CD8alpha, IMD116, Leu2, p32
Disease Acronyms (UniProt) Disease acronyms from UniProt database
IMD116
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize an
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
SNP ID Visualize variation Clinical significance Consequence
rs121918660 C>T Pathogenic Non coding transcript variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(40)
miRTarBase ID miRNA Experiments Reference
MIRT007284 hsa-miR-196b-5p Luciferase reporter assay 23359619
MIRT016928 hsa-miR-335-5p Microarray 18185580
MIRT876396 hsa-miR-140-5p CLIP-seq
MIRT876397 hsa-miR-2116 CLIP-seq
MIRT876398 hsa-miR-3617 CLIP-seq
Transcription factors
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
ETS1 Activation 8413295
GATA3 Activation 8413295
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(20)
GO ID Ontology Definition Evidence Reference
GO:0002456 Process T cell mediated immunity IBA 21873635
GO:0005515 Function Protein binding IPI 2470098, 2493728, 9177355, 12853576
GO:0005576 Component Extracellular region IEA
GO:0005886 Component Plasma membrane IDA 2784196
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
186910 1706 ENSG00000153563
Protein
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P01732
Protein name T-cell surface glycoprotein CD8 alpha chain (T-lymphocyte differentiation antigen T8/Leu-2) (CD antigen CD8a)
Protein function Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:p
PDB 1AKJ , 1CD8 , 1Q69 , 2HP4 , 3QZW , 7UMG , 7UVF , 8EW6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 26 → 133 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphoc
Sequence 
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN
SIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA
CDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Sequence length 235
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
T cell receptor signaling pathway
Yersinia infection
Primary immunodeficiency 		  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Bronchiectasis Bronchiectasis rs121908758, rs121908811, rs76649725, rs267606722, rs121909008, rs387906360, rs387906361, rs80034486, rs74767530, rs121908776, rs121909012, rs77646904, rs121908754, rs121909015, rs121909016
View all (214 more)
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Chronic obstructive pulmonary disease Chronic Obstructive Airway Disease 17950725 ClinVar
Show/Hide Text Mining Associations (1086)
Associations from Text Mining
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 30087107
3 methylcrotonyl CoA carboxylase 1 deficiency Associate 34071045
Abnormalities Drug Induced Associate 12828563
Abnormalities Drug Induced Stimulate 33057635
Abortion Habitual Associate 25935494
Abortion Habitual Inhibit 28112260
Abortion Spontaneous Associate 32582176
Achalasia Addisonianism Alacrimia syndrome Associate 37830388
Acquired Immunodeficiency Syndrome Associate 10691923, 10844523, 11287558, 11699717, 11882044, 14722279, 17076553, 17804494, 19299722, 20947783, 2112749, 21256826, 21806677, 2572558, 30147699
View all (9 more)
Acquired Immunodeficiency Syndrome Stimulate 8137540