Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
925
Gene name Gene Name - the full gene name approved by the HGNC.
CD8 subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD8A
Synonyms (NCBI Gene) Gene synonyms aliases
CD8, CD8alpha, IMD116, Leu2, p32
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize an
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121918660 C>T Pathogenic Non coding transcript variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT007284 hsa-miR-196b-5p Luciferase reporter assay 23359619
MIRT016928 hsa-miR-335-5p Microarray 18185580
MIRT876396 hsa-miR-140-5p CLIP-seq
MIRT876397 hsa-miR-2116 CLIP-seq
MIRT876398 hsa-miR-3617 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
ETS1 Activation 8413295
GATA3 Activation 8413295
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002250 Process Adaptive immune response NAS 17145893, 22081144
GO:0002376 Process Immune system process IEA
GO:0002456 Process T cell mediated immunity IBA
GO:0005515 Function Protein binding IPI 2470098, 2493728, 9177355, 12853576
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
186910 1706 ENSG00000153563
Protein
UniProt ID P01732
Protein name T-cell surface glycoprotein CD8 alpha chain (T-lymphocyte differentiation antigen T8/Leu-2) (CD antigen CD8a)
Protein function Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:p
PDB 1AKJ , 1CD8 , 1Q69 , 2HP4 , 3QZW , 7UMG , 7UVF , 8EW6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 26 133 Immunoglobulin V-set domain Domain
Tissue specificity TISSUE SPECIFICITY: CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphoc
Sequence
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN
SIMYFSHFVPVFL
PAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA
CDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Sequence length 235
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
T cell receptor signaling pathway
Yersinia infection
Primary immunodeficiency
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
<