Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9244
Gene name Gene Name - the full gene name approved by the HGNC.
Cytokine receptor like factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CRLF1
Synonyms (NCBI Gene) Gene synonyms aliases
CISS, CISS1, CLF, CLF-1, NR6, zcytor5
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuro
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104894668 A>C Pathogenic Coding sequence variant, missense variant
rs104894670 C>T Benign, pathogenic Coding sequence variant, missense variant
rs137853143 A>C,G Pathogenic Coding sequence variant, missense variant
rs137853144 T>A Pathogenic Coding sequence variant, stop gained
rs137853145 G>A,C,T Pathogenic Synonymous variant, coding sequence variant, missense variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019983 hsa-miR-375 Microarray 20215506
MIRT023159 hsa-miR-124-3p Microarray 18668037
MIRT030308 hsa-miR-26b-5p Microarray 19088304
MIRT610083 hsa-miR-8485 HITS-CLIP 23824327
MIRT610082 hsa-miR-329-3p HITS-CLIP 23824327
Transcription factors
Transcription factor Regulation Reference
PLAG1 Activation 14712223
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001657 Process Ureteric bud development IEA
GO:0004896 Function Cytokine receptor activity IBA
GO:0005125 Function Cytokine activity IDA 10966616
GO:0005127 Function Ciliary neurotrophic factor receptor binding IDA 10966616
GO:0005515 Function Protein binding IPI 10966616, 19933857, 26858303
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604237 2364 ENSG00000006016
Protein
UniProt ID O75462
Protein name Cytokine receptor-like factor 1 (Cytokine-like factor 1) (CLF-1) (ZcytoR5)
Protein function In complex with CLCF1, forms a heterodimeric neurotropic cytokine that plays a crucial role during neuronal development (Probable). May also play a regulatory role in the immune system.
PDB 8D7H
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09067 EpoR_lig-bind 131 228 Erythropoietin receptor, ligand binding Domain
PF00041 fn3 236 317 Fibronectin type III domain Domain
Tissue specificity TISSUE SPECIFICITY: Highest levels of expression observed in spleen, thymus, lymph node, appendix, bone marrow, stomach, placenta, heart, thyroid and ovary. Strongly expressed also in fetal lung. {ECO:0000269|PubMed:9686600}.
Sequence
MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTLLIGSSLLATC
SVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARD
GSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQ
DNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLD
ILDVVTTDPPPD
VHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAG
LKPGTVYFVQVRCNPFG
IYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSS
GPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGP
AR
Sequence length 422
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    IL-6-type cytokine receptor ligand interactions
Interleukin-27 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Cold-Induced Sweating Syndrome cold-induced sweating syndrome 1, cold-induced sweating syndrome rs137853929, rs137853932, rs768727082, rs761746361, rs137853928, rs137853143, rs1555758035, rs137853144, rs2145329741, rs1600650861, rs137853145, rs367543004 N/A
Cone-rod dystrophy Cone-rod dystrophy 12 rs137853932 N/A
Crisponi syndrome Crisponi/Cold-induced sweating syndrome rs1600651228 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Idiopathic achalasia idiopathic achalasia N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anemia Refractory with Excess of Blasts Stimulate 25679997
Arthritis Juvenile Stimulate 36167601
Carcinoma Ovarian Epithelial Associate 27378695
Cartilage Diseases Associate 17935617
Crisponi syndrome Associate 17436251, 17436252, 27392078
Drug Related Side Effects and Adverse Reactions Associate 23818941
Hematologic Neoplasms Associate 25679997
Inflammation Associate 39580860
Mesothelioma Malignant Associate 37047661
Myelodysplastic Syndromes Stimulate 25679997