Gene Gene information from NCBI Gene database.
Entrez ID 9242
Gene name Musculin
Gene symbol MSC
Synonyms (NCBI Gene)
ABF-1ABF1MYORbHLHa22
Chromosome 8
Chromosome location 8q13.3
Summary The protein encoded by this gene is a transcriptional repressor capable of binding an E-box element either as a homodimer or as a heterodimer with E2A in vitro. The encoded protein also forms heterodimers with E2A proteins in vivo. This protein is capable
miRNA miRNA information provided by mirtarbase database.
114
miRTarBase ID miRNA Experiments Reference
MIRT006681 hsa-miR-378a-3p Luciferase reporter assay 21471220
MIRT006681 hsa-miR-378a-3p Luciferase reporter assay 21471220
MIRT045694 hsa-miR-146a-5p CLASH 23622248
MIRT489466 hsa-miR-4259 PAR-CLIP 23592263
MIRT489465 hsa-miR-1203 PAR-CLIP 23592263
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
EPAS1 Activation 21081659
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 9584154
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603628 7321 ENSG00000178860
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60682
Protein name Musculin (Activated B-cell factor 1) (ABF-1) (Class A basic helix-loop-helix protein 22) (bHLHa22)
Protein function Transcription repressor capable of inhibiting the transactivation capability of TCF3/E47. May play a role in regulating antigen-dependent B-cell differentiation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 108 160 Helix-loop-helix DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in lymphoid tissues, B-cell lines and activated B-cells.
Sequence
MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCA
LGTAGSAEGCKRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARM
RVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLR
QLLQEDRYENGYVHPVNLTW
PFVVSGRPDSDTKEVSAANRLCGTTA
Sequence length 206
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
KIDNEY FAILURE, CHRONIC Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Carcinoma Hepatocellular Associate 30670911, 38287833
★☆☆☆☆
Found in Text Mining only
Cleft Palate Associate 36589413
★☆☆☆☆
Found in Text Mining only
Fetal Alcohol Spectrum Disorders Associate 37047575
★☆☆☆☆
Found in Text Mining only
Hereditary leiomyomatosis and renal cell cancer Associate 12588891
★☆☆☆☆
Found in Text Mining only
Hodgkin Disease Associate 12588891, 20519630
★☆☆☆☆
Found in Text Mining only
Lymphoma Associate 21088137
★☆☆☆☆
Found in Text Mining only
Lymphoma Large Cell Anaplastic Associate 31101622
★☆☆☆☆
Found in Text Mining only
Melanoma Associate 30333196
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 30670911
★☆☆☆☆
Found in Text Mining only
Prostatic Neoplasms Associate 35715447
★☆☆☆☆
Found in Text Mining only