NOG (noggin)

Gene

• Entrez ID: 9241
• Gene name: Noggin
• Gene symbol: NOG
• Synonyms (NCBI Gene): SYM1, SYNS1, SYNS1A
• Chromosome: 17
• Chromosome location: 17q22
• Summary: The secreted polypeptide, encoded by this gene, binds and inactivates members of the transforming growth factor-beta (TGF-beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP4). By diffusing through extracellular matrices more e

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs28937580	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs104894602	A>G	Pathogenic	Missense variant, coding sequence variant
rs104894603	T>G	Pathogenic	Missense variant, coding sequence variant
rs104894608	C>T	Pathogenic	Missense variant, coding sequence variant
rs104894609	G>T	Pathogenic	Missense variant, coding sequence variant
rs104894610	G>A,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs104894611	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs104894612	G>A	Pathogenic	Missense variant, coding sequence variant
rs104894613	T>A	Pathogenic	Stop gained, coding sequence variant
rs104894614	C>T	Pathogenic	Stop gained, coding sequence variant
rs104894615	G>C	Pathogenic	Missense variant, coding sequence variant
rs121908948	T>C,G	Pathogenic	Coding sequence variant, missense variant
rs121908949	C>G	Pathogenic	Coding sequence variant, missense variant
rs387906844	C>G,T	Pathogenic	Synonymous variant, coding sequence variant, missense variant
rs1064796941	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1567745111	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1567745119	G>A	Pathogenic	Stop gained, coding sequence variant
rs1597919829	->G	Pathogenic	Frameshift variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT288330	hsa-miR-200c-3p	qRT-PCR	23294929
MIRT288330	hsa-miR-200c-3p	qRT-PCR	23294929
MIRT2283671	hsa-miR-101	CLIP-seq
MIRT2283672	hsa-miR-144	CLIP-seq
MIRT2283673	hsa-miR-181a	CLIP-seq
MIRT2283674	hsa-miR-181b	CLIP-seq
MIRT2283675	hsa-miR-181c	CLIP-seq
MIRT2283676	hsa-miR-181d	CLIP-seq
MIRT2283677	hsa-miR-329	CLIP-seq
MIRT2283678	hsa-miR-362-3p	CLIP-seq
MIRT2283679	hsa-miR-3685	CLIP-seq
MIRT2283680	hsa-miR-3941	CLIP-seq
MIRT2283681	hsa-miR-4262	CLIP-seq
MIRT2283682	hsa-miR-4789-3p	CLIP-seq
MIRT2283683	hsa-miR-4789-5p	CLIP-seq
MIRT2283684	hsa-miR-603	CLIP-seq
MIRT2283685	hsa-miR-936	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0001501	Process	Skeletal system development	IEA
GO:0001501	Process	Skeletal system development	IEA
GO:0001501	Process	Skeletal system development	TAS	10080184
GO:0001649	Process	Osteoblast differentiation	IBA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001649	Process	Osteoblast differentiation	ISS	10780858
GO:0001655	Process	Urogenital system development	IEA
GO:0001657	Process	Ureteric bud development	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001706	Process	Endoderm formation	IEA
GO:0001707	Process	Mesoderm formation	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	ISS	10780858
GO:0001839	Process	Neural plate morphogenesis	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0003149	Process	Membranous septum morphogenesis	IEA
GO:0003149	Process	Membranous septum morphogenesis	ISS
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003151	Process	Outflow tract morphogenesis	ISS
GO:0003223	Process	Ventricular compact myocardium morphogenesis	IEA
GO:0003223	Process	Ventricular compact myocardium morphogenesis	ISS
GO:0003272	Process	Endocardial cushion formation	IEA
GO:0003272	Process	Endocardial cushion formation	ISS
GO:0005515	Function	Protein binding	IPI	19804412, 21976273, 24098149
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	7666191, 11562478
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	10080184
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007389	Process	Pattern specification process	IEA
GO:0007399	Process	Nervous system development	TAS	7666191
GO:0007411	Process	Axon guidance	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0007420	Process	Brain development	IEA
GO:0007492	Process	Endoderm development	IEA
GO:0007498	Process	Mesoderm development	IDA	8752214
GO:0008045	Process	Motor neuron axon guidance	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008542	Process	Visual learning	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0009953	Process	Dorsal/ventral pattern formation	IBA
GO:0009953	Process	Dorsal/ventral pattern formation	IDA	7666191
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0019838	Function	Growth factor binding	IPI	8752214
GO:0021510	Process	Spinal cord development	IEA
GO:0021533	Process	Cell differentiation in hindbrain	IMP	8582276
GO:0021915	Process	Neural tube development	IEA
GO:0021983	Process	Pituitary gland development	IEA
GO:0021999	Process	Neural plate anterior/posterior regionalization	IMP	8582276
GO:0030154	Process	Cell differentiation	IEA
GO:0030336	Process	Negative regulation of cell migration	IDA	20675382
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030510	Process	Regulation of BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IBA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IDA	8752214, 10780858, 15539560
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	ISS
GO:0030900	Process	Forebrain development	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IMP	17889703
GO:0035640	Process	Exploration behavior	IEA
GO:0038092	Process	Nodal signaling pathway	IMP	8582276
GO:0040036	Process	Regulation of fibroblast growth factor receptor signaling pathway	IMP	8582276
GO:0042060	Process	Wound healing	IEA
GO:0042060	Process	Wound healing	ISS	10780858
GO:0042474	Process	Middle ear morphogenesis	IMP	10080184
GO:0042733	Process	Embryonic digit morphogenesis	IMP	10080184
GO:0042803	Function	Protein homodimerization activity	IDA	11562478
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IDA	20675382
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048168	Process	Regulation of neuronal synaptic plasticity	IEA
GO:0048318	Process	Axial mesoderm development	IEA
GO:0048562	Process	Embryonic organ morphogenesis	IEA
GO:0048570	Process	Notochord morphogenesis	IEA
GO:0048646	Process	Anatomical structure formation involved in morphogenesis	IEA
GO:0048706	Process	Embryonic skeletal system development	IMP	10080184
GO:0048712	Process	Negative regulation of astrocyte differentiation	IEA
GO:0048712	Process	Negative regulation of astrocyte differentiation	ISS	10780858
GO:0048762	Process	Mesenchymal cell differentiation	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0055009	Process	Atrial cardiac muscle tissue morphogenesis	IEA
GO:0055009	Process	Atrial cardiac muscle tissue morphogenesis	ISS
GO:0060044	Process	Negative regulation of cardiac muscle cell proliferation	IEA
GO:0060044	Process	Negative regulation of cardiac muscle cell proliferation	ISS	10780858
GO:0060173	Process	Limb development	IMP	10080184
GO:0060272	Process	Embryonic skeletal joint morphogenesis	IMP	16151340
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0060325	Process	Face morphogenesis	IEA
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IDA	15539560
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0060425	Process	Lung morphogenesis	IEA
GO:0060513	Process	Prostatic bud formation	IEA
GO:0060676	Process	Ureteric bud formation	IEA
GO:0061037	Process	Negative regulation of cartilage development	IEA
GO:0061053	Process	Somite development	IEA
GO:0061384	Process	Heart trabecula morphogenesis	IEA
GO:0061384	Process	Heart trabecula morphogenesis	ISS
GO:0061626	Process	Pharyngeal arch artery morphogenesis	IEA
GO:0061626	Process	Pharyngeal arch artery morphogenesis	ISS
GO:0062044	Process	Negative regulation of cardiac epithelial to mesenchymal transition	IEA
GO:0062044	Process	Negative regulation of cardiac epithelial to mesenchymal transition	ISS
GO:0071773	Process	Cellular response to BMP stimulus	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	15539560
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IEA
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	ISS
GO:0090193	Process	Positive regulation of glomerulus development	IEA
GO:0090193	Process	Positive regulation of glomerulus development	ISS
GO:0098793	Component	Presynapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:0141069	Function	Receptor ligand inhibitor activity	IDA	8752214
GO:1904888	Process	Cranial skeletal system development	IEA
GO:1990926	Process	Short-term synaptic potentiation	IEA
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 602991
• HGNC: 7866
• e!Ensembl: ENSG00000183691

Protein

• UniProt ID: Q13253
• Protein name: Noggin
• Protein function: Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite. Essential for cartilage morphogenesis and joint formation. Inhibits chondrocyte differentiation through its inter
• PDB: 1M4U, 7AG0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05806	Noggin	12 → 232		Family

• Sequence:

  MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKD
  LNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEI
  KGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFS
  KRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

• Sequence length: 232

Pathways

KEGG:

TGF-beta signaling pathway

Reactome:

Signaling by BMP

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Brachydactyly type B2	Likely pathogenic; Pathogenic	rs1328705140, rs121908949, rs28937580	RCV001730032 RCV000007092 RCV000007094 RCV000007100	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
NOG-related disorder	Pathogenic; Likely pathogenic	rs2145567621, rs2545137863, rs121908949, rs2545137784	RCV001842239 RCV004529273 RCV004542632 RCV004531924	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
NOG-related-symphlangism spectrum disorder	Pathogenic	rs1354515769	RCV001528101	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Proximal symphalangism 1A	Likely pathogenic; Pathogenic	rs2145567535, rs104894602, rs121908948, rs104894608, rs104894609, rs104894611, rs104894612, rs104894613, rs28937580, rs1567745111	RCV001526526 RCV000007079 RCV000007080 RCV000007082 RCV000007083 RCV000049267 RCV000007089 RCV000007090 RCV000007093 RCV000735694	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Stapes ankylosis with broad thumbs and toes	Pathogenic; Likely pathogenic	rs28937580, rs104894614, rs749247710, rs2545137857, rs2545137910	RCV000579390 RCV000007096 RCV000007097 RCV003884004 RCV004585122	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Symphalangism-brachydactyly syndrome	Pathogenic	rs104894603, rs2145567008, rs1567745119, rs104894615, rs745356934, rs387906844, rs1597919829	RCV000007081 RCV000007091 RCV000007098 RCV000007099 RCV004557231 RCV000023225 RCV001027730	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Tarsal-carpal coalition syndrome	Likely pathogenic; Pathogenic	rs104894602, rs104894610, rs104894611	RCV000007087 RCV000007084 RCV000007085	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRACHYDACTYLY, TYPE B2	—	CTD, HPO CTD, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON WART	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOSYNOSTOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUSHING'S SYMPHALANGISM	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMIMELIA OF LIMB NOS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROPIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SYNOSTOSES SYNDROME	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SYNOSTOSES SYNDROME 1	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SYNOSTOSIS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DETACHMENT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Acro Osteolysis	Associate	14753748, 21249149	★☆☆☆☆ Found in Text Mining only
Ankylosis	Associate	32791904	★☆☆☆☆ Found in Text Mining only
Anophthalmos with limb anomalies	Associate	23361222	★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Associate	23483047	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Inhibit	33463122	★☆☆☆☆ Found in Text Mining only
Bone Cysts	Associate	21249149	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Inhibit	21249149	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Associate	22547073, 23799295	★☆☆☆☆ Found in Text Mining only
Brachydactyly Type B1	Associate	17668388	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Associate	36529041	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	22547073, 30850363	★☆☆☆☆ Found in Text Mining only
Calcinosis	Inhibit	34954251	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Associate	36529041	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Associate	31262291, 34242216	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	23638973, 34526059, 34841646	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Associate	27983534	★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Associate	11545688, 12089654, 14753748, 15066478, 31370824, 31694554, 32478388, 7557985	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deafness	Associate	31694554, 32791904, 33308208	★☆☆☆☆ Found in Text Mining only
Deafness Progressive With Stapes Fixation	Associate	26474326, 33308208	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Associate	30609838	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Associate	33308208	★☆☆☆☆ Found in Text Mining only
Esophageal Atresia	Associate	22083168	★☆☆☆☆ Found in Text Mining only
Esophageal atresia with or without tracheoesophageal fistula	Associate	22083168	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	22364398	★☆☆☆☆ Found in Text Mining only
Facial Neoplasms	Associate	23361222	★☆☆☆☆ Found in Text Mining only
Fibrocartilaginous embolism	Associate	26809343	★☆☆☆☆ Found in Text Mining only
Fused Kidney	Associate	31370824, 34334433	★☆☆☆☆ Found in Text Mining only
Genetic Predisposition to Disease	Associate	31694554	★☆☆☆☆ Found in Text Mining only
Glaucoma	Associate	27293372	★☆☆☆☆ Found in Text Mining only
Glioma	Associate	18492260, 25808628	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Associate	25815513	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Associate	31694554	★☆☆☆☆ Found in Text Mining only
Hearing Loss Conductive	Associate	12089654, 23361222, 26474326, 32478388, 34049328	★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Associate	22503063	★☆☆☆☆ Found in Text Mining only
Hyperopia	Associate	12089654	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperostosis Diffuse Idiopathic Skeletal	Associate	37156767	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Inhibit	36529041	★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	20336693	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Associate	39519354	★☆☆☆☆ Found in Text Mining only
Iridogoniodysgenesis and skeletal anomalies	Associate	12089654, 22288654	★☆☆☆☆ Found in Text Mining only
Low Back Pain	Associate	39519354	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	18560367	★☆☆☆☆ Found in Text Mining only
Mengel Konigsmark syndrome	Associate	23361222	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	20679527	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	30609838	★☆☆☆☆ Found in Text Mining only
Musculoskeletal Abnormalities	Associate	22288654	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	18931653, 21249149, 22547073	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	21249149, 22364398, 23826422, 34001012	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	40571310	★☆☆☆☆ Found in Text Mining only
Nerve Degeneration	Inhibit	39519354	★☆☆☆☆ Found in Text Mining only
NOG Related Symphalangism Spectrum Disorder	Associate	11545688, 12089654, 22288654, 25815513, 26474326, 34049328, 35332702	★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Associate	26738566	★☆☆☆☆ Found in Text Mining only
Otosclerosis	Associate	12089654	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	40571310	★☆☆☆☆ Found in Text Mining only
Primary Ovarian Insufficiency	Associate	15066478	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	18931653	★☆☆☆☆ Found in Text Mining only
Radioulnar Synostosis	Associate	31138930, 36984532	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency Chronic	Inhibit	30602563	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Associate	27293372	★☆☆☆☆ Found in Text Mining only
Ring Chromosome 20 Syndrome	Inhibit	36529041	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Associate	22984568	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	31698994	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	34001012	★☆☆☆☆ Found in Text Mining only
Stroke	Associate	30760287, 31391037	★☆☆☆☆ Found in Text Mining only
Symphalangism Distal	Associate	22288654, 31694554	★☆☆☆☆ Found in Text Mining only
Synostosis	Associate	16532400, 22288654, 35332702	★☆☆☆☆ Found in Text Mining only
Tarsal Coalition	Associate	34334433	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	23826422	★☆☆☆☆ Found in Text Mining only
Tracheoesophageal Fistula	Associate	22083168	★☆☆☆☆ Found in Text Mining only