IL32 (interleukin 32)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9235
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 32
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL32
Synonyms (NCBI Gene) Gene synonyms aliases
IL-32alpha, IL-32beta, IL-32delta, IL-32gamma, NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased af
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(53)
miRTarBase ID miRNA Experiments Reference
MIRT005564 hsa-miR-205-5p Luciferase reporter assay, qRT-PCR, Western blot 20737563
MIRT005564 hsa-miR-205-5p Luciferase reporter assay, qRT-PCR, Western blot 20737563
MIRT027524 hsa-miR-98-5p Microarray 19088304
MIRT437870 hsa-miR-29b-3p Luciferase reporter assay 23729669
MIRT437870 hsa-miR-29b-3p Luciferase reporter assay 23729669
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
DNMT1 Repression 20889550
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(15)
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 16488976, 23814099, 24396867, 32296183
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IEA
GO:0005615 Component Extracellular space TAS 1729377
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
606001 16830 ENSG00000008517
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P24001
Protein name Interleukin-32 (IL-32) (Natural killer cells protein 4) (Tumor necrosis factor alpha-inducing factor)
Protein function Cytokine that may play a role in innate and adaptive immune responses. It induces various cytokines such as TNFA/TNF-alpha and IL8. It activates typical cytokine signal pathways of NF-kappa-B and p38 MAPK.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15225 IL32 114 → 210 Interleukin 32 Family
Tissue specificity TISSUE SPECIFICITY: Selectively expressed in lymphocytes. Expression is more prominent in immune cells than in non-immune cells. {ECO:0000269|PubMed:15664165}.
Sequence 
MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLC
LSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLE
KERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKV
VALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
Sequence length 234
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction   Other interleukin signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Endometriosis Endometriosis N/A N/A GWAS
Show/Hide Text Mining Associations (128)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 39616313
Acute Lung Injury Associate 21649914
Acute On Chronic Liver Failure Associate 26241657
Allergic Fungal Sinusitis Associate 21899560
Aneurysm Associate 32434199
Aortic Aneurysm Abdominal Associate 32434199
Arthritis Juvenile Associate 26057774
Arthritis Rheumatoid Associate 16464743, 19248119, 19740314, 20615213, 22890997, 23190696, 28134327, 30232372
Arthritis Rheumatoid Stimulate 20112365, 23517397
Asthma Associate 25157456, 26151454, 39868576