Gene Gene information from NCBI Gene database.
Entrez ID 9235
Gene name Interleukin 32
Gene symbol IL32
Synonyms (NCBI Gene)
IL-32alphaIL-32betaIL-32deltaIL-32gammaNK4TAIFTAIFaTAIFbTAIFcTAIFd
Chromosome 16
Chromosome location 16p13.3
Summary This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased af
miRNA miRNA information provided by mirtarbase database.
53
miRTarBase ID miRNA Experiments Reference
MIRT005564 hsa-miR-205-5p Luciferase reporter assayqRT-PCRWestern blot 20737563
MIRT005564 hsa-miR-205-5p Luciferase reporter assayqRT-PCRWestern blot 20737563
MIRT027524 hsa-miR-98-5p Microarray 19088304
MIRT437870 hsa-miR-29b-3p Luciferase reporter assay 23729669
MIRT437870 hsa-miR-29b-3p Luciferase reporter assay 23729669
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
DNMT1 Repression 20889550
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 16488976, 23814099, 24396867, 32296183
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IEA
GO:0005615 Component Extracellular space TAS 1729377
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606001 16830 ENSG00000008517
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P24001
Protein name Interleukin-32 (IL-32) (Natural killer cells protein 4) (Tumor necrosis factor alpha-inducing factor)
Protein function Cytokine that may play a role in innate and adaptive immune responses. It induces various cytokines such as TNFA/TNF-alpha and IL8. It activates typical cytokine signal pathways of NF-kappa-B and p38 MAPK.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15225 IL32 114 210 Interleukin 32 Family
Tissue specificity TISSUE SPECIFICITY: Selectively expressed in lymphocytes. Expression is more prominent in immune cells than in non-immune cells. {ECO:0000269|PubMed:15664165}.
Sequence
MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLC
LSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLE
KERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKV
VALVHAVQALWKQFQSFCCSLSELFMSSFQ
SYGAPRGDKEELTPQKCSEPQSSK
Sequence length 234
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction   Other interleukin signaling