Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
92344
Gene name Gene Name - the full gene name approved by the HGNC.
Golgin, RAB6 interacting
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GORAB
Synonyms (NCBI Gene) Gene synonyms aliases
GO, NTKLBP1, SCYL1BP1
Disease Acronyms (UniProt) Disease acronyms from UniProt database
GO
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the golgin family, a group of coiled-coil proteins localized to the Golgi. The encoded protein may function in the secretory pathway. The encoded protein, which also localizes to the cytoplasm, was identified by interactions
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs119455951 G>A,T Pathogenic Missense variant, stop gained, coding sequence variant, 5 prime UTR variant, non coding transcript variant
rs119455952 C>T Pathogenic Genic downstream transcript variant, non coding transcript variant, stop gained, coding sequence variant
rs183596463 G>A,C,T Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs749490786 T>C Likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs1085307068 GA>- Likely-pathogenic Frameshift variant, 5 prime UTR variant, coding sequence variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT646106 hsa-miR-224-5p HITS-CLIP 23824327
MIRT646105 hsa-miR-501-5p HITS-CLIP 23824327
MIRT646104 hsa-miR-7852-3p HITS-CLIP 23824327
MIRT646103 hsa-miR-4703-3p HITS-CLIP 23824327
MIRT646102 hsa-miR-6875-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15781263, 20598683, 32296183
GO:0005654 Component Nucleoplasm IDA
GO:0005730 Component Nucleolus IDA
GO:0005737 Component Cytoplasm ISS
GO:0005794 Component Golgi apparatus IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607983 25676 ENSG00000120370
Protein
UniProt ID Q5T7V8
Protein name RAB6-interacting golgin (N-terminal kinase-like-binding protein 1) (NTKL-BP1) (NTKL-binding protein 1) (hNTKL-BP1) (SCY1-like 1-binding protein 1) (SCYL1-BP1) (SCYL1-binding protein 1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04949 Transcrip_act 154 301 Transcriptional activator Family
Sequence
MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSR
QQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNVQKPPFSSPTLPSHFTLTSPV
GDGQPQGIESQPKELGLENSHDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRL
MEEKNKRKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASL
DYSYARKRFDRAEAEYIAAKLDIQRKTEIKEQLTEHLCTIIQQNELRKAKKLEELMQQLD
V
EADEETLELEVEVERLLHEQEVESRRPVVRLERPFQPAEESVTLEFAKENRKCQEQAVS
PKVDDQCGNSSSIPFLSPNCPNQEGNDISAALAT
Sequence length 394
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  p53 signaling pathway  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Cutis laxa Cutis Laxa rs80356758, rs80356750, rs119489101, rs119489102, rs193302865, rs121918374, rs121918375, rs1598354372, rs1371235353, rs1598358449, rs121918376, rs121918377, rs121918378, rs137854453, rs1797225811
View all (31 more)
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Geroderma osteodysplastica Geroderma osteodysplastica rs119455951, rs119455952, rs1330106644, rs183596463, rs1085307068, rs1557999318, rs369967804, rs1571243797, rs1571232872 18997784, 26000619, 19681135
Mental retardation Mild Mental Retardation, Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
Unknown
Disease term Disease name Evidence References Source
Atrial Fibrillation Atrial Fibrillation GWAS
Cardioembolic Stroke Cardioembolic Stroke GWAS
Associations from Text Mining
Disease Name Relationship Type References
Gerodermia osteodysplastica Associate 18997784, 30631079
Leukoencephalopathies Associate 23963297