SCGB3A1 (secretoglobin family 3A member 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 92304
Gene name Secretoglobin family 3A member 1
Gene symbol SCGB3A1
Synonyms (NCBI Gene)
HIN-1HIN1LU105PnSP-2UGRP2
Chromosome 5
Chromosome location 5q35.3
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT018827 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (14)
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005125 Function Cytokine activity NAS 11481438
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space HDA 16502470
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
606500 18384 ENSG00000161055
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96QR1
Protein name Secretoglobin family 3A member 1 (Cytokine HIN-1) (High in normal 1) (Pneumo secretory protein 2) (PnSP-2) (Uteroglobin-related protein 2)
Protein function Secreted cytokine-like protein. Inhibits cell growth in vitro.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in lung and prostate (PubMed:11481438). Also found in mammary gland, spleen, pancreas, testis and liver (PubMed:11481438). Detected throughout the airway epithelium in lung, with highest expression in large airways (Pu
Sequence 
MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLL
LSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG
Sequence length 104
Interactions View interactions