SCGB3A1 (secretoglobin family 3A member 1)

Gene
Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
92304
Gene name Gene Name - the full gene name approved by the HGNC.
Secretoglobin family 3A member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SCGB3A1
Synonyms (NCBI Gene) Gene synonyms aliases
HIN-1, HIN1, LU105, PnSP-2, UGRP2
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q35.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT018827 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(14)
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005125 Function Cytokine activity NAS 11481438
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space HDA 16502470
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
606500 18384 ENSG00000161055
Protein
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Q96QR1
Protein name Secretoglobin family 3A member 1 (Cytokine HIN-1) (High in normal 1) (Pneumo secretory protein 2) (PnSP-2) (Uteroglobin-related protein 2)
Protein function Secreted cytokine-like protein. Inhibits cell growth in vitro.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in lung and prostate (PubMed:11481438). Also found in mammary gland, spleen, pancreas, testis and liver (PubMed:11481438). Detected throughout the airway epithelium in lung, with highest expression in large airways (Pu
Sequence 
MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLL
LSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG
Sequence length 104
Interactions View interactions
<