Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	923
Gene name Gene Name - the full gene name approved by the HGNC.	CD6 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CD6
Synonyms (NCBI Gene) Gene synonyms aliases	TP120
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q12.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion mol

Show/Hide all(73)

miRTarBase ID	miRNA	Experiments
MIRT876092	hsa-let-7a	CLIP-seq
MIRT876093	hsa-let-7b	CLIP-seq
MIRT876094	hsa-let-7c	CLIP-seq
MIRT876095	hsa-let-7d	CLIP-seq
MIRT876096	hsa-let-7e	CLIP-seq
MIRT876097	hsa-let-7f	CLIP-seq
MIRT876098	hsa-let-7g	CLIP-seq
MIRT876099	hsa-let-7i	CLIP-seq
MIRT876100	hsa-miR-103a	CLIP-seq
MIRT876101	hsa-miR-107	CLIP-seq
MIRT876102	hsa-miR-1184	CLIP-seq
MIRT876103	hsa-miR-1226	CLIP-seq
MIRT876104	hsa-miR-1470	CLIP-seq
MIRT876105	hsa-miR-15a	CLIP-seq
MIRT876106	hsa-miR-15b	CLIP-seq
MIRT876107	hsa-miR-16	CLIP-seq
MIRT876108	hsa-miR-1915	CLIP-seq
MIRT876109	hsa-miR-195	CLIP-seq
MIRT876110	hsa-miR-1976	CLIP-seq
MIRT876111	hsa-miR-324-5p	CLIP-seq
MIRT876112	hsa-miR-335	CLIP-seq
MIRT876113	hsa-miR-3622b-5p	CLIP-seq
MIRT876114	hsa-miR-424	CLIP-seq
MIRT876115	hsa-miR-4290	CLIP-seq
MIRT876116	hsa-miR-4458	CLIP-seq
MIRT876117	hsa-miR-4500	CLIP-seq
MIRT876118	hsa-miR-4667-3p	CLIP-seq
MIRT876119	hsa-miR-4720-5p	CLIP-seq
MIRT876120	hsa-miR-4726-3p	CLIP-seq
MIRT876121	hsa-miR-4799-3p	CLIP-seq
MIRT876122	hsa-miR-497	CLIP-seq
MIRT876123	hsa-miR-665	CLIP-seq
MIRT876124	hsa-miR-98	CLIP-seq
MIRT876123	hsa-miR-665	CLIP-seq
MIRT876118	hsa-miR-4667-3p	CLIP-seq
MIRT876100	hsa-miR-103a	CLIP-seq
MIRT876101	hsa-miR-107	CLIP-seq
MIRT876102	hsa-miR-1184	CLIP-seq
MIRT876105	hsa-miR-15a	CLIP-seq
MIRT876106	hsa-miR-15b	CLIP-seq
MIRT876107	hsa-miR-16	CLIP-seq
MIRT876109	hsa-miR-195	CLIP-seq
MIRT876110	hsa-miR-1976	CLIP-seq
MIRT2385754	hsa-miR-296-5p	CLIP-seq
MIRT876114	hsa-miR-424	CLIP-seq
MIRT876115	hsa-miR-4290	CLIP-seq
MIRT876118	hsa-miR-4667-3p	CLIP-seq
MIRT876122	hsa-miR-497	CLIP-seq
MIRT876092	hsa-let-7a	CLIP-seq
MIRT876093	hsa-let-7b	CLIP-seq
MIRT876094	hsa-let-7c	CLIP-seq
MIRT876095	hsa-let-7d	CLIP-seq
MIRT876096	hsa-let-7e	CLIP-seq
MIRT876097	hsa-let-7f	CLIP-seq
MIRT876098	hsa-let-7g	CLIP-seq
MIRT876099	hsa-let-7i	CLIP-seq
MIRT876103	hsa-miR-1226	CLIP-seq
MIRT876112	hsa-miR-335	CLIP-seq
MIRT876116	hsa-miR-4458	CLIP-seq
MIRT876117	hsa-miR-4500	CLIP-seq
MIRT876124	hsa-miR-98	CLIP-seq
MIRT2677759	hsa-miR-3195	CLIP-seq
MIRT2677760	hsa-miR-330-3p	CLIP-seq
MIRT2677761	hsa-miR-4269	CLIP-seq
MIRT2677762	hsa-miR-4514	CLIP-seq
MIRT2677763	hsa-miR-4692	CLIP-seq
MIRT2677764	hsa-miR-4742-5p	CLIP-seq
MIRT2677765	hsa-miR-510	CLIP-seq
MIRT2677766	hsa-miR-518a-3p	CLIP-seq
MIRT2677767	hsa-miR-518b	CLIP-seq
MIRT2677768	hsa-miR-518c	CLIP-seq
MIRT2677769	hsa-miR-518d-3p	CLIP-seq
MIRT2677770	hsa-miR-518f	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
ETS1	Unknown	19446338
RUNX1	Unknown	19446338
RUNX3	Unknown	19446338

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IDA	17601777
GO:0001771	Process	Immunological synapse formation	IMP	15294938
GO:0001772	Component	Immunological synapse	IDA	15294938
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002438	Process	Acute inflammatory response to antigenic stimulus	IDA	17601777
GO:0005515	Function	Protein binding	IPI	24584089, 24945728, 26146185, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IDA	15294938
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1919444
GO:0007155	Process	Cell adhesion	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	16352806
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	17601777
GO:0032496	Process	Response to lipopolysaccharide	IDA	17601777
GO:0042101	Component	T cell receptor complex	IDA	15294938
GO:0042102	Process	Positive regulation of T cell proliferation	IMP	15294938
GO:0042802	Function	Identical protein binding	IPI	26146185
GO:0045087	Process	Innate immune response	IEA
GO:0070891	Function	Lipoteichoic acid binding	IMP	17601777
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	17601777

MIM	HGNC	e!Ensembl
186720	1691	ENSG00000013725

Protein

UniProt ID

P30203

Protein name

T-cell differentiation antigen CD6 (T12) (TP120) (CD antigen CD6) [Cleaved into: Soluble CD6]

Protein function

Cell adhesion molecule that mediates cell-cell contacts and regulates T-cell responses via its interaction with ALCAM/CD166 (PubMed:15048703, PubMed:15294938, PubMed:16352806, PubMed:16914752, PubMed:24584089, PubMed:24945728). Contributes to si

PDB

5A2E

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00530	SRCR	48 → 156	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	164 → 260	Scavenger receptor cysteine-rich domain	Domain
PF00530	SRCR	268 → 361	Scavenger receptor cysteine-rich domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected on thymocytes (PubMed:15294938). Detected on peripheral blood T-cells (PubMed:15048703, PubMed:16352806). Detected on natural killer (NK) cells (PubMed:16352806). Soluble CD6 is detected in blood serum (at protein level) (PubM

Sequence

MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEV
RLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANAT
LAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHG
EWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDC
PGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAK
VLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLC
SASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELMLLIPSIVLGILLLGSLIFIA
FILLRIKGKYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDS
GSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTA
NPGHCITDPPSLGPQYHPRSNSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPP
NLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDND
DYDDISAA

Sequence length

668

Interactions

View interactions

	KEGG
	Cell adhesion molecules

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Eczema	Eczema	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (34)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Anemia Hemolytic Autoimmune	Associate	10583274
Aneurysm Ruptured	Associate	38538213
Arthritis Juvenile	Associate	34963488
Arthritis Rheumatoid	Associate	10693872, 22685579, 24890719
Arthritis Rheumatoid	Inhibit	35487454
Autoimmune Diseases	Associate	10583274, 24890719
Behcet Syndrome	Associate	27108704
Breast Neoplasms	Associate	40391211
Chorioamnionitis	Associate	39237269
Dermatitis Atopic	Associate	28821884
Disease	Associate	27217703
Duodenal Ulcer	Associate	36678166
Graft vs Host Disease	Associate	1967216
Hematologic Diseases	Associate	10583274
Hepatitis Autoimmune	Associate	36159854
Inflammatory Bowel Diseases	Associate	32641083
Intracranial Aneurysm	Associate	38538213
Leukemia	Associate	16818773
Leukemia Lymphocytic Chronic B Cell	Associate	9108402, 9885225
Leukemia Myeloid Acute	Associate	34619772
Liver Failure	Associate	36159854
Lymphoma Non Hodgkin	Associate	3310650
Multiple Sclerosis	Associate	19525953, 19825846, 19865102, 21552549, 23638056, 24890719, 36451826
Neoplasms	Associate	23573331, 23696937, 40391211
Neutropenia	Associate	10583274
Optic Neuritis	Associate	24130718
Prostate Cancer Hereditary 7	Associate	35767366
Prostatic Hyperplasia	Associate	39390078
Prostatic Neoplasms	Associate	35767366
Psoriasis	Associate	24890719
Purpura Thrombocytopenic Idiopathic	Associate	10583274
Red Cell Aplasia Pure	Associate	10583274
Squamous Cell Carcinoma of Head and Neck	Associate	36378845
Stroke	Associate	36253349

CD6 (CD6 molecule)