Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9229
Gene name Gene Name - the full gene name approved by the HGNC.	DLG associated protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DLGAP1
Synonyms (NCBI Gene) Gene synonyms aliases	DAP-1, DAP-1-ALPHA, DAP-1-BETA, DAP1, DLGAP1A, DLGAP1B, GKAP, SAPAP1
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18p11.31

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments
MIRT938489	hsa-miR-125a-5p	CLIP-seq
MIRT938490	hsa-miR-125b	CLIP-seq
MIRT938491	hsa-miR-186	CLIP-seq
MIRT938492	hsa-miR-3140-3p	CLIP-seq
MIRT938493	hsa-miR-3942-3p	CLIP-seq
MIRT938494	hsa-miR-4319	CLIP-seq
MIRT938495	hsa-miR-4446-5p	CLIP-seq
MIRT938496	hsa-miR-4686	CLIP-seq
MIRT938497	hsa-miR-4732-3p	CLIP-seq
MIRT938498	hsa-miR-4755-5p	CLIP-seq
MIRT938499	hsa-miR-4775	CLIP-seq
MIRT938500	hsa-miR-670	CLIP-seq
MIRT938501	hsa-miR-3182	CLIP-seq
MIRT938502	hsa-miR-3672	CLIP-seq
MIRT938503	hsa-miR-4461	CLIP-seq
MIRT1977686	hsa-miR-3944-5p	CLIP-seq
MIRT2428266	hsa-miR-137	CLIP-seq
MIRT938493	hsa-miR-3942-3p	CLIP-seq
MIRT2428267	hsa-miR-3977	CLIP-seq
MIRT2448302	hsa-miR-1291	CLIP-seq
MIRT2448303	hsa-miR-328	CLIP-seq
MIRT2448304	hsa-miR-34a	CLIP-seq
MIRT2448305	hsa-miR-34c-5p	CLIP-seq
MIRT2448306	hsa-miR-449a	CLIP-seq
MIRT2448307	hsa-miR-449b	CLIP-seq
MIRT2448308	hsa-miR-4639-3p	CLIP-seq
MIRT2448309	hsa-miR-4715-5p	CLIP-seq
MIRT2448310	hsa-miR-4727-5p	CLIP-seq
MIRT2448311	hsa-miR-4769-3p	CLIP-seq
MIRT2448312	hsa-miR-4799-5p	CLIP-seq
MIRT2516876	hsa-miR-145	CLIP-seq
MIRT2516877	hsa-miR-181a	CLIP-seq
MIRT2516878	hsa-miR-181b	CLIP-seq
MIRT2516879	hsa-miR-181c	CLIP-seq
MIRT2516880	hsa-miR-181d	CLIP-seq
MIRT2516881	hsa-miR-4262	CLIP-seq

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17474147, 20936779, 22117215
GO:0005575	Component	Cellular_component	ND
GO:0005886	Component	Plasma membrane	TAS
GO:0007268	Process	Chemical synaptic transmission	NAS	9286858
GO:0014069	Component	Postsynaptic density	IEA
GO:0044877	Function	Protein-containing complex binding	ISS
GO:0060090	Function	Molecular adaptor activity	IBA	21873635
GO:0098962	Process	Regulation of postsynaptic neurotransmitter receptor activity	IBA	21873635
GO:0098978	Component	Glutamatergic synapse	IBA	21873635
GO:0099572	Component	Postsynaptic specialization	IBA	21873635

MIM	HGNC	e!Ensembl
605445	2905	ENSG00000170579

Protein

UniProt ID

O14490

Protein name

Disks large-associated protein 1 (DAP-1) (Guanylate kinase-associated protein) (hGKAP) (PSD-95/SAP90-binding protein 1) (SAP90/PSD-95-associated protein 1) (SAPAP1)

Protein function

Part of the postsynaptic scaffold in neuronal cells.

PDB

5YPO , 6TNQ , 6TQ0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03359	GKAP	645 → 977	Guanylate-kinase-associated protein (GKAP) protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain.

Sequence

MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGP
FSDPLASSTFPRRHYTSQQELKDECALVPRTLATKANRIPANLLDQFERQLPLSRDGYHT
LQYKRTAVEHRSDSPGRIRHLVHSVQKLFTKSHSLEGPSKGSVNGGKASPDEAQAARYGK
RSKSKERRAEPKARPSTSPGWWSSDDNLDGDMCIYHAPSGVMTMGRCPDRSASQYFLEAY
NTISEQAVKASRSNNDVKCSTCANLPVSLDTPLLKKSAWSSTLTVSRAREVYQKASVNMD
QAMVKSESCQQERSCQYLQVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSD
TSPKPSPKVAARRESYLKATQPSLTELTTLKISNEHSPKLQIRSHSYLRAVSEVSINRSL
DSLDPAGLLTSPKFRSRNESYMRAMSTISQVSEMEVNGQFESVCESVFSELESQAVEALD
LPMPGCFRMRSHSYVRAIEKGCSQDDECVSLRSSSPPRTTTTVRTIQSSTVSSCITTYKK
TPPPVPPRTTTKPFISITAQSSTESAQDAYMDGQGQRGDIISQSGLSNSTESLDSMKALT
AAIEAANAQIHGPASQHMGNNTATVTTTTTIATVTTEDRKKDHFKKNRCLSIGIQVDDAE
EPDKTGENKAPSKFQSVGVQVEEEKCFRRFTRSNSVTTAVQADLDFHDNLENSLESIEDN
SCPGPMARQFSRDASTSTVSIQGSGNHYHACAADDDFDTDFDPSILPPPDPWIDSITEDP
LEAVQRSVCHRDGHWFLKLLQAERDRMEGWCQQMEREERENNLPEDILGKIRTAVGSAQL
LMAQKFYQFRELCEENLNPNAHPRPTSQDLAGFWDMLQLSIENISMKFDELHQLKANNWK
QMDPLDKKERRAPPPVPKKPAKGPAPLIRERSLESSQRQEARKRLMAAKRAASVRQNSAT
ESAESIEIYIPEAQTRL

Sequence length

977

Interactions

View interactions

	KEGG		Reactome
	Glutamatergic synapse		Neurexins and neuroligins

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Narcolepsy	Narcolepsy	rs104894574, rs387906655	19629137
Neurodevelopmental disorders	Neurodevelopmental Disorders	rs869312846, rs869312840, rs869312848, rs869312849, rs869312845, rs886041956, rs1064795110, rs1555762734, rs1555764992, rs1568512728, rs1568532361, rs1595472741, rs1595472764, rs1595476797, rs1016320330, rs1595127294, rs1600392059 View all (2 more)	28191889
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	12950712, 12784099, 22940546

Show/Hide Unknown Diseases (8)

Disease term	Disease name	Evidence	Source
Unknown
Eczema	Eczema		GWAS
Mental Depression	Mental Depression		GWAS
Hypertension	Hypertension		GWAS
Diabetes	Diabetes		GWAS
Dementia	Dementia		GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587	GWAS, CBGDA
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GWAS, CBGDA
Rheumatoid arthritis	Rheumatoid arthritis		GWAS

Show/Hide Text Mining Associations (32)

Disease Name	Relationship Type	References
Associations from Text Mining
Aging Premature	Associate	37110517
Attention Deficit Disorder with Hyperactivity	Associate	29484270
Breast Neoplasms	Associate	37110517
Carcinogenesis	Stimulate	35972892
Carcinogenesis	Associate	36376892
Carcinoma Hepatocellular	Associate	27221742, 33195697
Carcinoma Non Small Cell Lung	Associate	34454450
Carcinoma Non Small Cell Lung	Stimulate	35972892
Carcinoma Renal Cell	Associate	36611858
Cholangiocarcinoma	Stimulate	33301605
Cognition Disorders	Associate	29484270
Colorectal Neoplasms	Associate	36376892
Death	Associate	36267302
Diabetes Gestational	Associate	40298873
Embolism Fat	Associate	25950743
Glioblastoma	Stimulate	34536977
Glioblastoma	Associate	35341001
Glioma	Associate	33195697, 33301605, 34454450, 35113786, 35341001
Hypertension	Associate	34593835
Hypoxia	Stimulate	37817462
Lipoatrophy with diabetes hepatic steatosis cardiomyopathy and leukomelanodermic papules	Associate	25950743
Lung Neoplasms	Associate	40055367
Lymphatic Metastasis	Stimulate	34037089
Macular Degeneration	Associate	31367973
Melanoma	Associate	24188633
Neoplasm Metastasis	Associate	36376892, 37817462
Neoplasms	Stimulate	34037089, 37817462
Neoplasms	Inhibit	35972892, 40055367
Osteosarcoma	Associate	34852770, 37817462
Renal Insufficiency	Associate	34308739
Stomach Neoplasms	Associate	33080572, 34037089
Wilms Tumor	Associate	33301605

DLGAP1 (DLG associated protein 1)