Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9219
Gene name Gene Name - the full gene name approved by the HGNC.	Metastasis associated 1 family member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MTA2
Synonyms (NCBI Gene) Gene synonyms aliases	MTA1L1, PID
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q12.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that has been identified as a component of NuRD, a nucleosome remodeling deacetylase complex identified in the nucleus of human cells. It shows a very broad expression pattern and is strongly expressed in many tissues. It may r

Show/Hide all(127)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004731	hsa-miR-146a-5p	qRT-PCR, Western blot	20124483
MIRT004117	hsa-miR-661	Western blot	19584269
MIRT004116	hsa-miR-559	Western blot	19584269
MIRT017668	hsa-miR-335-5p	Microarray	18185580
MIRT025233	hsa-miR-34a-5p	Proteomics	21566225
MIRT025233	hsa-miR-34a-5p	Proteomics	21566225
MIRT025233	hsa-miR-34a-5p	Reporter assay;Western blot;Other	20018894
MIRT046730	hsa-miR-222-3p	CLASH	23622248
MIRT044965	hsa-miR-186-5p	CLASH	23622248
MIRT044044	hsa-miR-365a-3p	CLASH	23622248
MIRT042480	hsa-miR-423-3p	CLASH	23622248
MIRT041029	hsa-miR-505-3p	CLASH	23622248
MIRT040512	hsa-miR-548a-3p	CLASH	23622248
MIRT040292	hsa-miR-615-3p	CLASH	23622248
MIRT040292	hsa-miR-615-3p	CLASH	23622248
MIRT038634	hsa-miR-125b-2-3p	CLASH	23622248
MIRT737195	hsa-miR-589-3p	Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR	31452724
MIRT1162181	hsa-miR-1236	CLIP-seq
MIRT1162182	hsa-miR-146a	CLIP-seq
MIRT1162183	hsa-miR-146b-5p	CLIP-seq
MIRT1162184	hsa-miR-3145-5p	CLIP-seq
MIRT1162185	hsa-miR-3148	CLIP-seq
MIRT1162186	hsa-miR-3156-5p	CLIP-seq
MIRT1162187	hsa-miR-3687	CLIP-seq
MIRT1162188	hsa-miR-371-5p	CLIP-seq
MIRT1162189	hsa-miR-4251	CLIP-seq
MIRT1162190	hsa-miR-4278	CLIP-seq
MIRT1162191	hsa-miR-4303	CLIP-seq
MIRT1162192	hsa-miR-4311	CLIP-seq
MIRT1162193	hsa-miR-4329	CLIP-seq
MIRT1162194	hsa-miR-4442	CLIP-seq
MIRT1162195	hsa-miR-4496	CLIP-seq
MIRT1162196	hsa-miR-4688	CLIP-seq
MIRT1162197	hsa-miR-4762-3p	CLIP-seq
MIRT1162198	hsa-miR-589	CLIP-seq
MIRT1162181	hsa-miR-1236	CLIP-seq
MIRT2046489	hsa-miR-1321	CLIP-seq
MIRT2046490	hsa-miR-3591-3p	CLIP-seq
MIRT2046491	hsa-miR-4287	CLIP-seq
MIRT2046492	hsa-miR-4685-3p	CLIP-seq
MIRT2046493	hsa-miR-4685-5p	CLIP-seq
MIRT2046494	hsa-miR-4719	CLIP-seq
MIRT2046495	hsa-miR-4739	CLIP-seq
MIRT2046496	hsa-miR-4747-5p	CLIP-seq
MIRT2046497	hsa-miR-4756-5p	CLIP-seq
MIRT2046498	hsa-miR-483-3p	CLIP-seq
MIRT2046499	hsa-miR-513b	CLIP-seq
MIRT2046500	hsa-miR-570	CLIP-seq
MIRT2046501	hsa-miR-603	CLIP-seq
MIRT2275598	hsa-miR-1204	CLIP-seq
MIRT2275599	hsa-miR-1252	CLIP-seq
MIRT2275600	hsa-miR-1262	CLIP-seq
MIRT2275601	hsa-miR-1276	CLIP-seq
MIRT2275602	hsa-miR-1285	CLIP-seq
MIRT2046489	hsa-miR-1321	CLIP-seq
MIRT2275603	hsa-miR-146b-3p	CLIP-seq
MIRT2275604	hsa-miR-3170	CLIP-seq
MIRT2275605	hsa-miR-3173-5p	CLIP-seq
MIRT2275606	hsa-miR-3187-5p	CLIP-seq
MIRT2275607	hsa-miR-3945	CLIP-seq
MIRT2275608	hsa-miR-4253	CLIP-seq
MIRT2275609	hsa-miR-4292	CLIP-seq
MIRT2275610	hsa-miR-4533	CLIP-seq
MIRT2275611	hsa-miR-4701-3p	CLIP-seq
MIRT2046495	hsa-miR-4739	CLIP-seq
MIRT2046496	hsa-miR-4747-5p	CLIP-seq
MIRT2046497	hsa-miR-4756-5p	CLIP-seq
MIRT2275612	hsa-miR-612	CLIP-seq
MIRT2275613	hsa-miR-874	CLIP-seq
MIRT1162181	hsa-miR-1236	CLIP-seq
MIRT2438813	hsa-miR-3614-5p	CLIP-seq
MIRT2438814	hsa-miR-3680	CLIP-seq
MIRT2438815	hsa-miR-4760-3p	CLIP-seq
MIRT2046501	hsa-miR-603	CLIP-seq
MIRT1162181	hsa-miR-1236	CLIP-seq
MIRT2275600	hsa-miR-1262	CLIP-seq
MIRT2275602	hsa-miR-1285	CLIP-seq
MIRT2046489	hsa-miR-1321	CLIP-seq
MIRT2275603	hsa-miR-146b-3p	CLIP-seq
MIRT2275605	hsa-miR-3173-5p	CLIP-seq
MIRT2275606	hsa-miR-3187-5p	CLIP-seq
MIRT2574594	hsa-miR-3202	CLIP-seq
MIRT2438813	hsa-miR-3614-5p	CLIP-seq
MIRT2438814	hsa-miR-3680	CLIP-seq
MIRT2275607	hsa-miR-3945	CLIP-seq
MIRT2275608	hsa-miR-4253	CLIP-seq
MIRT2046491	hsa-miR-4287	CLIP-seq
MIRT2275609	hsa-miR-4292	CLIP-seq
MIRT2574595	hsa-miR-4464	CLIP-seq
MIRT2046492	hsa-miR-4685-3p	CLIP-seq
MIRT2574596	hsa-miR-4690-3p	CLIP-seq
MIRT2275611	hsa-miR-4701-3p	CLIP-seq
MIRT2046495	hsa-miR-4739	CLIP-seq
MIRT2046496	hsa-miR-4747-5p	CLIP-seq
MIRT2574597	hsa-miR-4748	CLIP-seq
MIRT2046497	hsa-miR-4756-5p	CLIP-seq
MIRT2438815	hsa-miR-4760-3p	CLIP-seq
MIRT2046498	hsa-miR-483-3p	CLIP-seq
MIRT2046501	hsa-miR-603	CLIP-seq
MIRT2275612	hsa-miR-612	CLIP-seq
MIRT2275613	hsa-miR-874	CLIP-seq
MIRT1162181	hsa-miR-1236	CLIP-seq
MIRT2275600	hsa-miR-1262	CLIP-seq
MIRT2275602	hsa-miR-1285	CLIP-seq
MIRT2046489	hsa-miR-1321	CLIP-seq
MIRT2275603	hsa-miR-146b-3p	CLIP-seq
MIRT2275605	hsa-miR-3173-5p	CLIP-seq
MIRT2275606	hsa-miR-3187-5p	CLIP-seq
MIRT2574594	hsa-miR-3202	CLIP-seq
MIRT2438813	hsa-miR-3614-5p	CLIP-seq
MIRT2438814	hsa-miR-3680	CLIP-seq
MIRT2275607	hsa-miR-3945	CLIP-seq
MIRT2275608	hsa-miR-4253	CLIP-seq
MIRT2046491	hsa-miR-4287	CLIP-seq
MIRT2275609	hsa-miR-4292	CLIP-seq
MIRT2574595	hsa-miR-4464	CLIP-seq
MIRT2046492	hsa-miR-4685-3p	CLIP-seq
MIRT2275611	hsa-miR-4701-3p	CLIP-seq
MIRT2046495	hsa-miR-4739	CLIP-seq
MIRT2046496	hsa-miR-4747-5p	CLIP-seq
MIRT2574597	hsa-miR-4748	CLIP-seq
MIRT2046497	hsa-miR-4756-5p	CLIP-seq
MIRT2438815	hsa-miR-4760-3p	CLIP-seq
MIRT2046498	hsa-miR-483-3p	CLIP-seq
MIRT2046501	hsa-miR-603	CLIP-seq
MIRT2275612	hsa-miR-612	CLIP-seq
MIRT2275613	hsa-miR-874	CLIP-seq

Show/Hide all(47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IEA
GO:0000118	Component	Histone deacetylase complex	TAS	10444591
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000781	Component	Chromosome, telomeric region	IDA	25150861
GO:0000785	Component	Chromatin	HDA	16217013
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0004407	Function	Histone deacetylase activity	IEA
GO:0005515	Function	Protein binding	IPI	17646674, 17956988, 18451879, 19703393, 20127688, 21258344, 23752268, 24981860, 25150861, 26028330, 26030138, 26496610, 26949739, 27705803, 28179136, 28514442, 31980649, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	28977666, 33283408
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	15920471
GO:0006325	Process	Chromatin organization	TAS	10444591
GO:0006338	Process	Chromatin remodeling	HDA	16217013
GO:0006338	Process	Chromatin remodeling	IDA	9790534
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010762	Process	Regulation of fibroblast migration	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016581	Component	NuRD complex	IBA
GO:0016581	Component	NuRD complex	IDA	19644445, 22926524, 33283408
GO:0016581	Component	NuRD complex	IEA
GO:0016581	Component	NuRD complex	NAS	16428440
GO:0031492	Function	Nucleosomal DNA binding	HDA	16217013
GO:0032991	Component	Protein-containing complex	HDA	16217013
GO:0042659	Process	Regulation of cell fate specification	NAS	22560079
GO:0042826	Function	Histone deacetylase binding	IBA
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	NAS	22560079
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	19927129
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	15920471, 22926524
GO:0071514	Process	Genomic imprinting	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:2000736	Process	Regulation of stem cell differentiation	NAS	22560079

MIM	HGNC	e!Ensembl
603947	7411	ENSG00000149480

Protein

UniProt ID

O94776

Protein name

Metastasis-associated protein MTA2 (Metastasis-associated 1-like 1) (MTA1-L1 protein) (p53 target protein in deacetylase complex)

Protein function

May function as a transcriptional coregulator (PubMed:16428440, PubMed:28977666). Acts as a component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin (PubMed:16428440, PubMed:28977666). {ECO:0000269|PubM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01426	BAH	4 → 144	BAH domain	Domain
PF01448	ELM2	147 → 199	ELM2 domain	Family
PF00320	GATA	367 → 404	GATA zinc finger	Domain
PF17226	MTA_R1	447 → 524	MTA R1 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed.

Sequence

MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLAD
SNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQY
LEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWD
PDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQR
NGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSL
ASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAG
FQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEP
HSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAAR
RPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKT
PINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPAD
APNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPAST
NEPIVLED

Sequence length

668

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling		HDACs deacetylate histones Regulation of TP53 Activity through Acetylation RNA Polymerase I Transcription Initiation Regulation of PTEN gene transcription

MTA2 (metastasis associated 1 family member 2)