Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9218
Gene name Gene Name - the full gene name approved by the HGNC.
VAMP associated protein A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VAPA
Synonyms (NCBI Gene) Gene synonyms aliases
VAMP-A, VAP-33, VAP-A, VAP33, hVAP-33
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18p11.22
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein co
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016124 hsa-miR-421 Sequencing 20371350
MIRT027325 hsa-miR-101-3p Sequencing 20371350
MIRT665500 hsa-miR-6750-3p HITS-CLIP 23824327
MIRT665499 hsa-miR-8485 HITS-CLIP 23824327
MIRT665498 hsa-miR-3680-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IDA 24209621
GO:0005515 Function Protein binding IPI 10544080, 16227268, 16895911, 16996479, 18160438, 19289470, 19515777, 19615732, 20029029, 21900206, 21957124, 21976701, 22045669, 23736259, 23840749, 23935497, 24105263, 24209621, 25616068, 25681634, 25910212, 26496610, 26618866, 28298427, 28377464, 29858488, 29997244, 30659099, 307
GO:0005634 Component Nucleus IEA
GO:0005783 Component Endoplasmic reticulum HDA 16791210
GO:0005783 Component Endoplasmic reticulum IDA 18713837, 19289470
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605703 12648 ENSG00000101558
Protein
UniProt ID Q9P0L0
Protein name Vesicle-associated membrane protein-associated protein A (VAMP-A) (VAMP-associated protein A) (VAP-A) (33 kDa VAMP-associated protein) (VAP-33)
Protein function Endoplasmic reticulum (ER)-anchored protein that mediates the formation of contact sites between the ER and endosomes via interaction with FFAT motif-containing proteins such as STARD3 or WDR44 (PubMed:32344433, PubMed:33124732). STARD3-VAPA int
PDB 2RR3 , 6TQR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00635 Motile_Sperm 14 120 MSP (Major sperm protein) domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYC
VRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDE

LMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECK
RLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFI
GFFLGKFIL
Sequence length 249
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cholesterol metabolism   Sphingolipid de novo biosynthesis
Neutrophil degranulation
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer subtype (triple negative vs luminal A-like) N/A N/A GWAS
Breast cancer Invasive breast cancer N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Non Small Cell Lung Associate 34839824
Colorectal Neoplasms Associate 30797148
Leukemia Myelogenous Chronic BCR ABL Positive Associate 26474455
Myocardial Infarction Associate 29049183
Neoplasm Metastasis Associate 34839824, 35428233
Neoplasms Associate 34839824
Squamous Cell Carcinoma of Head and Neck Associate 34102907
Trisomy 18 Syndrome Associate 21152411