Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	92170
Gene name	Mitochondrial ribosome associated GTPase 1
Gene symbol	MTG1
Synonyms (NCBI Gene)	GTPGTPBP7
Chromosome	10
Chromosome location	10q26.3

Show/Hide all (57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041976	hsa-miR-484	CLASH	23622248
MIRT040253	hsa-miR-615-3p	CLASH	23622248
MIRT647826	hsa-miR-4323	HITS-CLIP	19536157
MIRT647827	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT647823	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT647822	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT647821	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT710882	hsa-miR-4758-3p	HITS-CLIP	19536157
MIRT647818	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT647817	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT647816	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT710881	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT647828	hsa-miR-634	HITS-CLIP	23824327
MIRT647826	hsa-miR-4323	HITS-CLIP	23824327
MIRT647827	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT647825	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT647824	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT647823	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT647822	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT647821	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT647820	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT647819	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT647818	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT647817	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT647816	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT647826	hsa-miR-4323	HITS-CLIP	19536157
MIRT647827	hsa-miR-1224-3p	HITS-CLIP	19536157
MIRT647823	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT647822	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT647821	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT710882	hsa-miR-4758-3p	HITS-CLIP	19536157
MIRT647818	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT647817	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT647816	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT710881	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT647828	hsa-miR-634	HITS-CLIP	23824327
MIRT647826	hsa-miR-4323	HITS-CLIP	23824327
MIRT647827	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT647825	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT647824	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT647823	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT647822	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT647821	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT647820	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT647819	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT647818	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT647817	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT647816	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT1163103	hsa-miR-1266	CLIP-seq
MIRT1163104	hsa-miR-4270	CLIP-seq
MIRT1163105	hsa-miR-4441	CLIP-seq
MIRT1163106	hsa-miR-4518	CLIP-seq
MIRT1163107	hsa-miR-4646-5p	CLIP-seq
MIRT1163108	hsa-miR-558	CLIP-seq
MIRT1163109	hsa-miR-767-3p	CLIP-seq
MIRT2275941	hsa-miR-1972	CLIP-seq
MIRT2275942	hsa-miR-513a-5p	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	23396448
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005525	Function	GTP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	23396448
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	30085276
GO:0005759	Component	Mitochondrial matrix	IDA	23396448
GO:0005761	Component	Mitochondrial ribosome	IDA	23396448
GO:0006417	Process	Regulation of translation	IEA
GO:0016020	Component	Membrane	IEA
GO:0044065	Process	Regulation of respiratory system process	IMP	23396448
GO:0070129	Process	Regulation of mitochondrial translation	IMP	23396448
GO:1902775	Process	Mitochondrial large ribosomal subunit assembly	IMP	30085276

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9BT17

Protein name

Mitochondrial ribosome-associated GTPase 1 (GTP-binding protein 7) (Mitochondrial GTPase 1)

Protein function

Plays a role in the regulation of the mitochondrial ribosome assembly and of translational activity. Displays mitochondrial GTPase activity.

PDB

7O9K , 7O9M , 7PD3 , 8PK0 , 8QSJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01926	MMR_HSR1	145 → 292	50S ribosome-binding GTPase	Family

Sequence

MRLTPRALCSAAQAAWRENFPLCGRDVARWFPGHMAKGLKKMQSSLKLVDCIIEVHDARI
PLSGRNPLFQETLGLKPHLLVLNKMDLADLTEQQKIMQHLEGEGLKNVIFTNCVKDENVK
QIIPMVTELIGRSHRYHRKENLEYCIMVIGVPNVGKSSLINSLRRQHLRKGKATRVGGEP
GITRAVMSKIQVSERPLMFLLDTPGVLAPRIESVETGLKLALCGTVLDHLVGEETMADYL
LYTLNKHQRFGYVQHYGLGSACDNVERVLKSVAVKLGKTQKVKVLTGTGNVNIIQPNYPA
AARDFLQTFRRGLLGSVMLDLDVLRGHPPAETLP

Sequence length

334

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Neoplasms	Associate	34385605, 35320117	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Muscle Tissue	Associate	34385605	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stress Disorders Post Traumatic	Associate	35999196	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vulvar Diseases	Associate	36177509	★★★★★ ★☆☆☆☆ Found in Text Mining only

MTG1 (mitochondrial ribosome associated GTPase 1)