Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9212
Gene name Gene Name - the full gene name approved by the HGNC.	Aurora kinase B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	AURKB
Synonyms (NCBI Gene) Gene synonyms aliases	AIK2, AIM-1, AIM1, ARK-2, ARK2, AurB, IPL1, PPP1R48, STK-1, STK12, STK5, aurkb-sv1, aurkb-sv2
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17p13.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 19 and 20. These kinases participate in the regulation of alignment and segregatio

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1597343914	G>A	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant

Show/Hide all(67)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004742	hsa-miR-16-5p	Microarray, qRT-PCR	19738602
MIRT004742	hsa-miR-16-5p	Microarray, qRT-PCR	19738602
MIRT004742	hsa-miR-16-5p	Microarray, qRT-PCR	19738602
MIRT000120	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19748357
MIRT000120	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19748357
MIRT001649	hsa-let-7b-5p	pSILAC	18668040
MIRT020616	hsa-miR-155-5p	Proteomics	18668040
MIRT022319	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT000120	hsa-miR-24-3p	Reporter assay;Western blot;qRT-PCR;Other	19748357
MIRT004742	hsa-miR-16-5p	Proteomics	18668040
MIRT001649	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT049133	hsa-miR-92a-3p	CLASH	23622248
MIRT048044	hsa-miR-148a-3p	CLASH	23622248
MIRT046053	hsa-miR-125b-5p	CLASH	23622248
MIRT053129	hsa-let-7a-5p	Luciferase reporter assay, Western blot	23769985
MIRT053129	hsa-let-7a-5p	Luciferase reporter assay, Western blot	23769985
MIRT053129	hsa-let-7a-5p	Luciferase reporter assay, Western blot	23769985
MIRT437396	hsa-let-7e-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23774216
MIRT437396	hsa-let-7e-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23774216
MIRT001649	hsa-let-7b-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	32856506
MIRT812182	hsa-let-7a	CLIP-seq
MIRT812183	hsa-let-7b	CLIP-seq
MIRT812184	hsa-let-7c	CLIP-seq
MIRT812185	hsa-let-7d	CLIP-seq
MIRT812186	hsa-let-7e	CLIP-seq
MIRT812187	hsa-let-7f	CLIP-seq
MIRT812188	hsa-let-7g	CLIP-seq
MIRT812189	hsa-let-7i	CLIP-seq
MIRT812190	hsa-miR-1248	CLIP-seq
MIRT812191	hsa-miR-188-5p	CLIP-seq
MIRT812192	hsa-miR-3124-3p	CLIP-seq
MIRT812193	hsa-miR-3162-5p	CLIP-seq
MIRT812194	hsa-miR-3173-3p	CLIP-seq
MIRT812195	hsa-miR-3927	CLIP-seq
MIRT812196	hsa-miR-4458	CLIP-seq
MIRT812197	hsa-miR-4475	CLIP-seq
MIRT812198	hsa-miR-4500	CLIP-seq
MIRT812199	hsa-miR-4650-3p	CLIP-seq
MIRT812200	hsa-miR-4672	CLIP-seq
MIRT812201	hsa-miR-4713-3p	CLIP-seq
MIRT812202	hsa-miR-570	CLIP-seq
MIRT812203	hsa-miR-765	CLIP-seq
MIRT812204	hsa-miR-98	CLIP-seq
MIRT1940221	hsa-miR-1284	CLIP-seq
MIRT1940222	hsa-miR-3679-3p	CLIP-seq
MIRT812200	hsa-miR-4672	CLIP-seq
MIRT812182	hsa-let-7a	CLIP-seq
MIRT812183	hsa-let-7b	CLIP-seq
MIRT812184	hsa-let-7c	CLIP-seq
MIRT812185	hsa-let-7d	CLIP-seq
MIRT812186	hsa-let-7e	CLIP-seq
MIRT812187	hsa-let-7f	CLIP-seq
MIRT812188	hsa-let-7g	CLIP-seq
MIRT812189	hsa-let-7i	CLIP-seq
MIRT1940221	hsa-miR-1284	CLIP-seq
MIRT812191	hsa-miR-188-5p	CLIP-seq
MIRT812194	hsa-miR-3173-3p	CLIP-seq
MIRT812195	hsa-miR-3927	CLIP-seq
MIRT812196	hsa-miR-4458	CLIP-seq
MIRT812197	hsa-miR-4475	CLIP-seq
MIRT812198	hsa-miR-4500	CLIP-seq
MIRT812199	hsa-miR-4650-3p	CLIP-seq
MIRT812200	hsa-miR-4672	CLIP-seq
MIRT812201	hsa-miR-4713-3p	CLIP-seq
MIRT812202	hsa-miR-570	CLIP-seq
MIRT812203	hsa-miR-765	CLIP-seq
MIRT812204	hsa-miR-98	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
E2F1	Unknown	15033491
E2F4	Unknown	15033491

Show/Hide all(92)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	20959462
GO:0000166	Function	Nucleotide binding	IEA
GO:0000278	Process	Mitotic cell cycle	NAS	17956729
GO:0000281	Process	Mitotic cytokinesis	NAS	17956729
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000776	Component	Kinetochore	IDA	26829474
GO:0000776	Component	Kinetochore	IDA	22024163
GO:0000776	Component	Kinetochore	IEA
GO:0000779	Component	Condensed chromosome, centromeric region	IDA	18195732, 19465021
GO:0000779	Component	Condensed chromosome, centromeric region	IEA
GO:0000922	Component	Spindle pole	IBA
GO:0002903	Process	Negative regulation of B cell apoptotic process	IDA	20959462
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	21397845
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	26829474
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	18455984, 22371557, 22724069, 25666058, 28751710, 30100357, 30409912, 31804178, 33542149
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IEA
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	TAS	19774610
GO:0005515	Function	Protein binding	IPI	12689593, 15064709, 16179162, 16239925, 16291752, 17099693, 17543862, 17681274, 17726514, 17956729, 18243099, 18477699, 19357306, 20562864, 20739936, 20959462, 21051298, 21346195, 21988832, 22939624, 23036704, 24571573, 24857377, 25036637, 26829474, 27332895, 28514442, 29340707, 295
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	20959462
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005819	Component	Spindle	IEA
GO:0005819	Component	Spindle	TAS	19774610
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005876	Component	Spindle microtubule	IBA
GO:0007051	Process	Spindle organization	IMP	21820309
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0010369	Component	Chromocenter	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA	9859993
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019900	Function	Kinase binding	IPI	23036704
GO:0030496	Component	Midbody	IBA
GO:0030496	Component	Midbody	IDA	17726514
GO:0030496	Component	Midbody	IEA
GO:0030496	Component	Midbody	TAS	19774610
GO:0031117	Process	Positive regulation of microtubule depolymerization	IDA	31804178
GO:0032133	Component	Chromosome passenger complex	IBA
GO:0032133	Component	Chromosome passenger complex	IEA
GO:0032133	Component	Chromosome passenger complex	IPI	15260989, 17956729, 18591255
GO:0032133	Component	Chromosome passenger complex	TAS	19774610
GO:0032206	Process	Positive regulation of telomere maintenance	IMP	21531765
GO:0032465	Process	Regulation of cytokinesis	IBA
GO:0032466	Process	Negative regulation of cytokinesis	ISS
GO:0032467	Process	Positive regulation of cytokinesis	IMP	16103226
GO:0032467	Process	Positive regulation of cytokinesis	TAS	19774610
GO:0032886	Process	Regulation of microtubule-based process	IEA
GO:0034501	Process	Protein localization to kinetochore	IMP	19468067
GO:0034644	Process	Cellular response to UV	IDA	20959462
GO:0036089	Process	Cleavage furrow formation	IDA	16103226
GO:0036089	Process	Cleavage furrow formation	IEA
GO:0043687	Process	Post-translational protein modification	IEA
GO:0043687	Process	Post-translational protein modification	ISS
GO:0044839	Process	Cell cycle G2/M phase transition	IDA	33542149
GO:0044839	Process	Cell cycle G2/M phase transition	IEA
GO:0044878	Process	Mitotic cytokinesis checkpoint signaling	ISS
GO:0045824	Process	Negative regulation of innate immune response	IDA	33542149
GO:0051233	Component	Spindle midzone	IBA
GO:0051256	Process	Mitotic spindle midzone assembly	IMP	16103226
GO:0051256	Process	Mitotic spindle midzone assembly	NAS	17956729
GO:0051256	Process	Mitotic spindle midzone assembly	TAS	19774610
GO:0051301	Process	Cell division	IEA
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IDA	30409912
GO:0051983	Process	Regulation of chromosome segregation	TAS	19774610
GO:0061952	Process	Midbody abscission	ISS
GO:0062033	Process	Positive regulation of mitotic sister chromatid segregation	IDA	26829474, 30409912
GO:0090068	Process	Positive regulation of cell cycle process	IEA
GO:0090267	Process	Positive regulation of mitotic cell cycle spindle assembly checkpoint	NAS	17956729
GO:0090307	Process	Mitotic spindle assembly	NAS	17956729
GO:0097431	Component	Mitotic spindle pole	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0140273	Process	Repair of mitotic kinetochore microtubule attachment defect	IDA	22371557
GO:0140896	Process	CGAS/STING signaling pathway	IDA	32911482, 32912999
GO:0160049	Process	Negative regulation of cGAS/STING signaling pathway	IDA	33542149
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	IEA
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1901970	Process	Positive regulation of mitotic sister chromatid separation	NAS	17956729
GO:1902425	Process	Positive regulation of attachment of mitotic spindle microtubules to kinetochore	NAS	17956729
GO:1903490	Process	Positive regulation of mitotic cytokinesis	NAS	17956729
GO:1905116	Process	Positive regulation of lateral attachment of mitotic spindle microtubules to kinetochore	IDA	28751710
GO:1990023	Component	Mitotic spindle midzone	IEA
GO:1990758	Process	Mitotic sister chromatid biorientation	IDA	22371557

MIM	HGNC	e!Ensembl
604970	11390	ENSG00000178999

Protein

UniProt ID

Q96GD4

Protein name

Aurora kinase B (EC 2.7.11.1) (Aurora 1) (Aurora- and IPL1-like midbody-associated protein 1) (AIM-1) (Aurora/IPL1-related kinase 2) (ARK-2) (Aurora-related kinase 2) (STK-1) (Serine/threonine-protein kinase 12) (Serine/threonine-protein kinase 5) (Serine

Protein function

Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis (PubMed:11516652, PubMed:12925766, PubMed:14610074, PubMed:14722118, PubMed:29449677). The CPC complex has es

PDB

4AF3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	77 → 327	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: High level expression seen in the thymus. It is also expressed in the spleen, lung, testis, colon, placenta and fetal liver. Expressed during S and G2/M phase and expression is up-regulated in cancer cells during M phase. {ECO:0000269|

Sequence

MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA

Sequence length

344

Interactions

View interactions

	KEGG		Reactome
	Polycomb repressive complex Cell cycle		Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion SUMOylation of DNA replication proteins RHO GTPases Activate Formins Regulation of TP53 Activity through Phosphorylation Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Anxiety Disorder	Anxiety disorders	N/A	N/A	GWAS
Neuroticism	Neuroticism	N/A	N/A	GWAS

Show/Hide Text Mining Associations (96)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
2 Hydroxyglutaricaciduria	Associate	22971244
Adenocarcinoma of Lung	Associate	27610375, 33612479, 33684161, 34039308, 35354488
Adenocarcinoma of Lung	Stimulate	34397793
Adenomatous Polyps	Associate	26423403
Adrenocortical Carcinoma	Associate	30413320
Anemia Refractory	Stimulate	22419576
Aneuploidy	Associate	24782314, 29707994, 31967936, 33293370, 35044816
Astrocytoma	Associate	22971244, 27106762
Barrett Esophagus	Associate	21470402
Breast Neoplasms	Associate	21707964, 24324792, 25755770, 25885472, 29196757, 31083605, 31142743, 34736137, 35456460, 36281185, 40710353
Breast Neoplasms	Stimulate	36113844
Burkitt Lymphoma	Associate	37436268, 38099309
Calcinosis Cutis	Associate	19134008
Carcinogenesis	Associate	26061684, 28427193, 31894128, 31982864, 34736137
Carcinoma Hepatocellular	Associate	19134008, 20799978, 28427193, 29962817, 32337237, 32379058, 32627011
Carcinoma Merkel Cell	Associate	25531179
Carcinoma Non Small Cell Lung	Stimulate	16222316
Carcinoma Non Small Cell Lung	Associate	18708766, 26712741, 28095398, 29707994, 35058503, 38199330
Carcinoma Non Small Cell Lung	Inhibit	32300176
Carcinoma Ovarian Epithelial	Associate	37820923
Carcinoma Pancreatic Ductal	Associate	37096681
Carcinoma Renal Cell	Associate	26061684, 31489573, 32626756, 32986937, 34870494
Carcinoma Squamous Cell	Stimulate	28095398
Carcinoma Squamous Cell	Associate	32340320, 37442189
Cardiomyopathy Dilated	Associate	23695888
Cataract Nuclear Progressive	Associate	37021526
Chondrosarcoma	Inhibit	22809428
Chromosomal Instability	Associate	30513041
Chromosome Aberrations	Associate	20732714, 33277547
Colonic Neoplasms	Associate	26423403
Colorectal Neoplasms	Associate	26423403, 40018943
COVID 19	Associate	33839760, 36389792, 36856850, 36913345
Diabetes Gestational	Associate	30474315
Diffuse Intrinsic Pontine Glioma	Associate	22971244
Drug Related Side Effects and Adverse Reactions	Associate	23557198, 29196757, 31312514
Drug Related Side Effects and Adverse Reactions	Inhibit	37816716
Endometrial Neoplasms	Associate	23769985, 32727972
Esophageal Neoplasms	Associate	16572587
Esophageal Squamous Cell Carcinoma	Associate	21470402
Glioblastoma	Associate	17264249, 20467329, 22160182, 25553095, 34465813, 37644431
Glioma	Associate	20529377
Head and Neck Neoplasms	Associate	32083704
Headache	Associate	37436268
Hematologic Neoplasms	Associate	33277547
Hereditary Renal Cancer Associated 1	Associate	30190438
Infections	Inhibit	36992689
Leukemia	Associate	28662510
Leukemia Biphenotypic Acute	Stimulate	30733284
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	36175852
Leukemia Myeloid Acute	Associate	20732714, 22419576, 22940834, 23557198, 31207577, 34171263
Leukemia T Cell	Associate	22359551
Light Fixation Seizure Syndrome	Associate	26894859
Lung Neoplasms	Associate	18708766, 32655004
Lymphatic Metastasis	Associate	25755770
Lymphoma Non Hodgkin	Stimulate	23153524
Lymphoma T Cell	Associate	23153524, 37160920
Lymphoma T Cell Peripheral	Associate	23153524
Melanoma	Associate	25623468, 34812139
Mouth Neoplasms	Associate	32083704, 37641028
Mucocutaneous Lymph Node Syndrome	Associate	40455761
Multiple Myeloma	Associate	19171872
Myelodysplastic Syndromes	Associate	22419576, 23092930
Nasopharyngeal Carcinoma	Associate	35509856
Neoplasm Metastasis	Associate	25120775, 31122179, 33173433
Neoplasm Metastasis	Stimulate	28427193, 36113844
Neoplasms	Associate	16222316, 19074838, 19091947, 19134008, 19225156, 20799978, 21496390, 21679421, 21762492, 22283874, 22611192, 23153524, 23769985, 24074379, 24553122 View all (25 more)
Neoplasms	Inhibit	23759594
Neoplasms	Stimulate	24966962
Neoplasms Squamous Cell	Associate	21496390
Neurodegenerative Diseases	Associate	40229714
Nevus	Associate	34812139
Nevus Pigmented	Associate	34812139
Osteoarthritis	Associate	27866912
Osteosarcoma	Associate	24129234, 25120775, 25874486, 31122179
Ovarian Neoplasms	Associate	22895067, 26992217
Polyps	Associate	26423403
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	30733284, 32321174
Prostatic Neoplasms	Associate	23075505
Pulmonary Disease Chronic Obstructive	Associate	32655004
Radiation Injuries	Associate	26712741
Renal Insufficiency	Associate	31530649
Retinoblastoma	Associate	33704359
Sarcoma Ewing	Associate	19074838, 25483190
Sleep Deprivation	Associate	40229714
Sleep Wake Disorders	Associate	40229714
Small Cell Lung Carcinoma	Associate	23035247, 26772203, 37289191
Squamous Cell Carcinoma of Head and Neck	Associate	21496390, 24980817, 36165728, 36169922
Squamous Cell Carcinoma of Head and Neck	Inhibit	32300176
ST Elevation Myocardial Infarction	Associate	26367242
Stomach Neoplasms	Associate	31521144, 31982864
Sveinsson Chorioretinal Atrophy	Associate	36627281
Thyroid Carcinoma Anaplastic	Associate	30213925, 37675898
Triple Negative Breast Neoplasms	Associate	31312514, 36627281
Urinary Bladder Neoplasms	Associate	36181054, 36529823, 37740761, 39456780
Uterine Cervical Neoplasms	Associate	20622363
Virus Diseases	Associate	36557005

AURKB (aurora kinase B)