Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	92105
Gene name Gene Name - the full gene name approved by the HGNC.	Integrator complex subunit 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	INTS4
Synonyms (NCBI Gene) Gene synonyms aliases	INT4, MST093
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q14.1
Summary Summary of gene provided in NCBI Entrez Gene.	INTS4 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) (Ba

Show/Hide all(24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020869	hsa-miR-155-5p	Proteomics	18668040
MIRT048141	hsa-miR-197-3p	CLASH	23622248
MIRT037855	hsa-miR-455-3p	CLASH	23622248
MIRT2016593	hsa-miR-3154	CLIP-seq
MIRT2016594	hsa-miR-3653	CLIP-seq
MIRT2016595	hsa-miR-4425	CLIP-seq
MIRT2016596	hsa-miR-452	CLIP-seq
MIRT2016597	hsa-miR-4676-3p	CLIP-seq
MIRT2016598	hsa-miR-4717-5p	CLIP-seq
MIRT2016599	hsa-miR-4747-5p	CLIP-seq
MIRT2016600	hsa-miR-645	CLIP-seq
MIRT2016601	hsa-miR-7	CLIP-seq
MIRT2016593	hsa-miR-3154	CLIP-seq
MIRT2016594	hsa-miR-3653	CLIP-seq
MIRT2016598	hsa-miR-4717-5p	CLIP-seq
MIRT2016600	hsa-miR-645	CLIP-seq
MIRT2016593	hsa-miR-3154	CLIP-seq
MIRT2016594	hsa-miR-3653	CLIP-seq
MIRT2016598	hsa-miR-4717-5p	CLIP-seq
MIRT2016600	hsa-miR-645	CLIP-seq
MIRT2016593	hsa-miR-3154	CLIP-seq
MIRT2016594	hsa-miR-3653	CLIP-seq
MIRT2016598	hsa-miR-4717-5p	CLIP-seq
MIRT2016600	hsa-miR-645	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16239144, 25416956, 26871637, 31515488, 32296183, 33548203, 33961781
GO:0005634	Component	Nucleus	IDA	29471365, 39032489, 39032490
GO:0005634	Component	Nucleus	IDA	23904267
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	32647223
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	29471365
GO:0005737	Component	Cytoplasm	IEA
GO:0016180	Process	SnRNA processing	IBA
GO:0016180	Process	SnRNA processing	IDA	16239144
GO:0016180	Process	SnRNA processing	NAS	16239144
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	29471365, 33548203
GO:0032039	Component	Integrator complex	IBA
GO:0032039	Component	Integrator complex	IDA	16239144, 29471365, 33548203, 36920904, 39032489, 39032490
GO:0032039	Component	Integrator complex	NAS	33548203
GO:0034243	Process	Regulation of transcription elongation by RNA polymerase II	NAS	32697989
GO:0160232	Component	INTAC complex	IDA	33243860, 34004147, 34762484, 36869814, 38570683
GO:0160240	Process	RNA polymerase II transcription initiation surveillance	IDA	33243860, 34004147, 38570683

MIM	HGNC	e!Ensembl
611348	25048	ENSG00000149262

Protein

UniProt ID

Q96HW7

Protein name

Integrator complex subunit 4 (Int4)

Protein function

Component of the integrator complex, a multiprotein complex that terminates RNA polymerase II (Pol II) transcription in the promoter-proximal region of genes (PubMed:29471365, PubMed:33243860, PubMed:33548203, PubMed:38570683). The integrator co

PDB

7BFP , 7BFQ , 7CUN , 7PKS , 7YCX , 8R2D , 8RBX , 8RBZ , 8RC4 , 8YJB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12765	Cohesin_HEAT	178 → 218	HEAT repeat associated with sister chromatid cohesion	Family

Sequence

MAAHLKKRVYEEFTKVVQPQEEIATKKLRLTKPSKSAALHIDLCKATSPADALQYLLQFA
RKPVEAESVEGVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGFSPDCIMDDAINILQN
EKSHQVLAQLLDTLLAIGTKLPENQAIQMRLVDVACKHLTDTSHGVRNKCLQLLGNLGSL
EKSVTKDAEGLAARDVQKIIGDYFSDQDPRVRTAAIKAMLQLHERGLKLHQTIYNQACKL
LSDDYEQVRSAAVQLIWVVSQLYPESIVPIPSSNEEIRLVDDAFGKICHMVSDGSWVVRV
QAAKLLGSMEQVSSHFLEQTLDKKLMSDLRRKRTAHERAKELYSSGEFSSGRKWGDDAPK
EEVDTGAVNLIESGACGAFVHGLEDEMYEVRIAAVEALCMLAQSSPSFAEKCLDFLVDMF
NDEIEEVRLQSIHTMRKISNNITLREDQLDTVLAVLEDSSRDIREALHELLCCTNVSTKE
GIHLALVELLKNLTKYPTDRDSIWKCLKFLGSRHPTLVLPLVPELLSTHPFFDTAEPDMD
DPAYIAVLVLIFNAAKTCPTMPALFSDHTFRHYAYLRDSLSHLVPALRLPGRKLVSSAVS
PSIIPQEDPSQQFLQQSLERVYSLQHLDPQGAQELLEFTIRDLQRLGELQSELAGVADFS
ATYLRCQLLLIKALQEKLWNVAAPLYLKQSDLASAAAKQIMEETYKMEFMYSGVENKQVV
IIHHMRLQAKALQLIVTARTTRGLDPLFGMCEKFLQEVDFFQRYFIADLPHLQDSFVDKL
LDLMPRLMTSKPAEVVKILQTMLRQSAFLHLPLPEQIHKASATIIEPAGESDNPLRFTSG
LVVALDVDATLEHVQDPQNTVKVQVLYPDGQAQMIHPKPADFRNPGPGRHRLITQVYLSH
TAWTEACQVEVRLLLAYNSSARIPKCPWMEGGEMSPQVETSIEGTIPFSKPVKVYIMPKP
ARR

Sequence length

963

Interactions

View interactions

	Reactome
			RNA polymerase II transcribes snRNA genes

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Prostate cancer	Prostate cancer	N/A	N/A	GWAS

INTS4 (integrator complex subunit 4)