Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
921
Gene name Gene Name - the full gene name approved by the HGNC.
CD5 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD5
Synonyms (NCBI Gene) Gene synonyms aliases
LEU1, T1
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q12.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycop
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT875792 hsa-miR-1913 CLIP-seq
MIRT875793 hsa-miR-3064-5p CLIP-seq
MIRT875794 hsa-miR-324-3p CLIP-seq
MIRT875795 hsa-miR-3613-3p CLIP-seq
MIRT875796 hsa-miR-4272 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 1711157
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 11390434
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane NAS 1711157
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
153340 1685 ENSG00000110448
Protein
UniProt ID P06127
Protein name T-cell surface glycoprotein CD5 (Lymphocyte antigen T1/Leu-1) (CD antigen CD5)
Protein function Lymphoid-specific receptor expressed by all T-cells and in a subset of B-cells known as B1a cells. Plays a role in the regulation of TCR and BCR signaling, thymocyte selection, T-cell effector differentiation and immune tolerance. Acts by intera
PDB 2JA4 , 2JOP , 2JP0 , 2OTT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00530 SRCR 38 133 Scavenger receptor cysteine-rich domain Domain
Sequence
MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVC
SQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHS
RNDMCHSLGLTCL
EPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGS
LGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQ
NSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAAL
CDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYC
KKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGP
TGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPD
NSSDSDYDLHGAQRL
Sequence length 495
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Hematopoietic cell lineage  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypothyroidism Hypothyroidism N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Ablepharon macrostomia syndrome Associate 39457093
Abortion Habitual Associate 25935494
Achalasia Addisonianism Alacrimia syndrome Associate 32311849
Acute Disease Associate 7511004
Adenocarcinoma Associate 26643918
Adenoma Islet Cell Associate 28877912
Adenoma Pleomorphic Associate 26643918
alpha Thalassemia Associate 36099017
Alzheimer Disease Inhibit 39929297
Anemia Hemolytic Autoimmune Associate 10583274, 30784322, 31392938