CD4 (CD4 molecule)

Gene

• Entrez ID: 920
• Gene name: CD4 molecule
• Gene symbol: CD4
• Synonyms (NCBI Gene): CD4mut, IMD79, Leu-3, OKT4D, T4
• Disease Acronyms (UniProt): IMD79
• Chromosome: 12
• Chromosome location: 12p13.31
• Summary: This gene encodes the CD4 membrane glycoprotein of T lymphocytes. The CD4 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class II MHC molecules. The

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs28919570	C>T	Conflicting-interpretations-of-pathogenicity	Missense variant, 5 prime UTR variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT053201	hsa-miR-181a-5p	Flow, qRT-PCR, Western blot	23393335
MIRT720059	hsa-miR-4713-3p	HITS-CLIP	19536157
MIRT720058	hsa-miR-638	HITS-CLIP	19536157
MIRT720057	hsa-miR-450b-3p	HITS-CLIP	19536157
MIRT720056	hsa-miR-769-3p	HITS-CLIP	19536157
MIRT479660	hsa-miR-1273d	PAR-CLIP	23592263
MIRT479659	hsa-miR-5197-5p	PAR-CLIP	23592263
MIRT479658	hsa-miR-3125	PAR-CLIP	23592263
MIRT479657	hsa-miR-3916	PAR-CLIP	23592263
MIRT479656	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT479655	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT479654	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT479653	hsa-miR-665	PAR-CLIP	23592263
MIRT479652	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT479651	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT479650	hsa-miR-4786-3p	PAR-CLIP	23592263
MIRT479649	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT479648	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT479647	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT479646	hsa-miR-4470	PAR-CLIP	23592263
MIRT479645	hsa-miR-4505	PAR-CLIP	23592263
MIRT479644	hsa-miR-5787	PAR-CLIP	23592263
MIRT479643	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT479642	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT479641	hsa-miR-877-5p	PAR-CLIP	23592263
MIRT479640	hsa-miR-7843-3p	PAR-CLIP	23592263
MIRT479639	hsa-miR-3674	PAR-CLIP	23592263
MIRT733042	hsa-miR-375	ELISA, qRT-PCR, Western blotting	33938607
MIRT736025	hsa-miR-125b-5p	Microarray, qRT-PCR	33179091
MIRT736029	hsa-miR-155-5p	Microarray, qRT-PCR	33179091
MIRT720059	hsa-miR-4713-3p	HITS-CLIP	19536157
MIRT720058	hsa-miR-638	HITS-CLIP	19536157
MIRT720057	hsa-miR-450b-3p	HITS-CLIP	19536157
MIRT720056	hsa-miR-769-3p	HITS-CLIP	19536157
MIRT479660	hsa-miR-1273d	PAR-CLIP	23592263
MIRT479659	hsa-miR-5197-5p	PAR-CLIP	23592263
MIRT479658	hsa-miR-3125	PAR-CLIP	23592263
MIRT479657	hsa-miR-3916	PAR-CLIP	23592263
MIRT479656	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT479655	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT479654	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT479653	hsa-miR-665	PAR-CLIP	23592263
MIRT479652	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT479651	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT479650	hsa-miR-4786-3p	PAR-CLIP	23592263
MIRT479649	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT479648	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT479647	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT479646	hsa-miR-4470	PAR-CLIP	23592263
MIRT479645	hsa-miR-4505	PAR-CLIP	23592263
MIRT479644	hsa-miR-5787	PAR-CLIP	23592263
MIRT479643	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT479642	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT479641	hsa-miR-877-5p	PAR-CLIP	23592263
MIRT479640	hsa-miR-7843-3p	PAR-CLIP	23592263
MIRT479639	hsa-miR-3674	PAR-CLIP	23592263
MIRT875411	hsa-miR-1254	CLIP-seq
MIRT875412	hsa-miR-1321	CLIP-seq
MIRT875413	hsa-miR-3116	CLIP-seq
MIRT875414	hsa-miR-3151	CLIP-seq
MIRT875415	hsa-miR-3176	CLIP-seq
MIRT875416	hsa-miR-3919	CLIP-seq
MIRT875417	hsa-miR-3922-3p	CLIP-seq
MIRT875418	hsa-miR-4447	CLIP-seq
MIRT875419	hsa-miR-4455	CLIP-seq
MIRT875420	hsa-miR-4472	CLIP-seq
MIRT875421	hsa-miR-4475	CLIP-seq
MIRT875422	hsa-miR-4654	CLIP-seq
MIRT875423	hsa-miR-4712-3p	CLIP-seq
MIRT875424	hsa-miR-4728-5p	CLIP-seq
MIRT875425	hsa-miR-4739	CLIP-seq
MIRT875426	hsa-miR-4756-3p	CLIP-seq
MIRT875427	hsa-miR-4756-5p	CLIP-seq
MIRT875428	hsa-miR-4757-5p	CLIP-seq
MIRT875429	hsa-miR-4769-5p	CLIP-seq
MIRT875430	hsa-miR-4779	CLIP-seq
MIRT875431	hsa-miR-491-5p	CLIP-seq
MIRT875432	hsa-miR-539	CLIP-seq
MIRT875433	hsa-miR-555	CLIP-seq
MIRT875434	hsa-miR-661	CLIP-seq
MIRT875435	hsa-miR-765	CLIP-seq
MIRT875436	hsa-miR-1256	CLIP-seq
MIRT875437	hsa-miR-2355-3p	CLIP-seq
MIRT875438	hsa-miR-3140-5p	CLIP-seq
MIRT875439	hsa-miR-3688-5p	CLIP-seq
MIRT875421	hsa-miR-4475	CLIP-seq
MIRT875440	hsa-miR-4527	CLIP-seq
MIRT875441	hsa-miR-4646-3p	CLIP-seq
MIRT875442	hsa-miR-4710	CLIP-seq
MIRT875430	hsa-miR-4779	CLIP-seq
MIRT875443	hsa-miR-4790-3p	CLIP-seq
MIRT875444	hsa-miR-4792	CLIP-seq
MIRT875445	hsa-miR-516b	CLIP-seq
MIRT875433	hsa-miR-555	CLIP-seq
MIRT875446	hsa-miR-644	CLIP-seq
MIRT875435	hsa-miR-765	CLIP-seq
MIRT1959526	hsa-miR-1302	CLIP-seq
MIRT1959527	hsa-miR-1827	CLIP-seq
MIRT1959528	hsa-miR-3150a-3p	CLIP-seq
MIRT1959529	hsa-miR-3175	CLIP-seq
MIRT1959530	hsa-miR-4298	CLIP-seq
MIRT1959531	hsa-miR-4667-5p	CLIP-seq
MIRT1959532	hsa-miR-4700-5p	CLIP-seq
MIRT1959533	hsa-miR-939	CLIP-seq
MIRT2677705	hsa-miR-1224-3p	CLIP-seq
MIRT2677706	hsa-miR-1260	CLIP-seq
MIRT2677707	hsa-miR-1260b	CLIP-seq
MIRT2677708	hsa-miR-1280	CLIP-seq
MIRT2677709	hsa-miR-4281	CLIP-seq
MIRT2677710	hsa-miR-627	CLIP-seq
MIRT2677711	hsa-miR-924	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Unknown	9765424
EIF2AK2	Unknown	8995707
HES1	Repression	11287612
MAZ	Unknown	7760814
MYB	Repression	11287612
TCF3	Unknown	17486074

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	24942581
GO:0002250	Process	Adaptive immune response	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	10358157
GO:0005201	Function	Extracellular matrix structural constituent	NAS	12444132
GO:0005515	Function	Protein binding	IPI	7831289, 9168119, 10816381, 10922058, 11113139, 11264384, 15660419, 16888650, 17005671, 17301785, 19333378, 20080564, 20357769, 23890821, 26098315, 27114505, 30542158, 32814053
GO:0005769	Component	Early endosome	TAS
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IDA	2823150, 8124721, 11390434, 19333378
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IDA	24942581
GO:0006948	Process	Induction by virus of host cell-cell fusion	IDA	9166430
GO:0006955	Process	Immune response	NAS	8512039
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	TAS	9558100, 10358157
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9780207
GO:0007167	Process	Enzyme linked receptor protein signaling pathway	TAS	10358157
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	NAS	8512039
GO:0008270	Function	Zinc ion binding	IDA	9668045
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0009897	Component	External side of plasma membrane	IDA	17213291
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	IEA
GO:0015026	Function	Coreceptor activity	NAS	8512039
GO:0019064	Process	Fusion of virus membrane with host plasma membrane	TAS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019865	Function	Immunoglobulin binding	IEA
GO:0019899	Function	Enzyme binding	IPI	19333378
GO:0019901	Function	Protein kinase binding	IPI	7486703
GO:0023026	Function	MHC class II protein complex binding	IDA	27114505
GO:0030217	Process	T cell differentiation	IDA	1533274
GO:0030225	Process	Macrophage differentiation	IMP	24942581
GO:0030665	Component	Clathrin-coated vesicle membrane	TAS
GO:0032355	Process	Response to estradiol	IEA
GO:0032507	Process	Maintenance of protein location in cell	IDA	15128768
GO:0032743	Process	Positive regulation of interleukin-2 production	NAS	1901411
GO:0033280	Process	Response to vitamin D	IEA
GO:0033674	Process	Positive regulation of kinase activity	IDA	24942581
GO:0035397	Process	Helper T cell enhancement of adaptive immune response	IEA
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IBA	21873635
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IDA	24942581
GO:0038023	Function	Signaling receptor activity	TAS	10413516
GO:0042011	Function	Interleukin-16 binding	IPI	24942581
GO:0042012	Function	Interleukin-16 receptor activity	IDA	24942581
GO:0042101	Component	T cell receptor complex	NAS	8512039
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042110	Process	T cell activation	IBA	21873635
GO:0042289	Function	MHC class II protein binding	IBA	21873635
GO:0042289	Function	MHC class II protein binding	IDA	2823150, 11535811
GO:0042289	Function	MHC class II protein binding	IPI	24942581
GO:0042289	Function	MHC class II protein binding	NAS	8512039
GO:0042802	Function	Identical protein binding	IPI	9168119
GO:0042803	Function	Protein homodimerization activity	IDA	9168119, 12444132
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	24942581
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	24942581
GO:0045058	Process	T cell selection	IDA	9551897
GO:0045121	Component	Membrane raft	IBA	21873635
GO:0045121	Component	Membrane raft	IDA	9168119
GO:0045657	Process	Positive regulation of monocyte differentiation	IDA	24942581
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	2118992
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	24942581
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	24942581
GO:0050690	Process	Regulation of defense response to virus by virus	TAS
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IEA
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0050863	Process	Regulation of T cell activation	IDA	1533274
GO:0051924	Process	Regulation of calcium ion transport	IDA	24942581
GO:0061024	Process	Membrane organization	TAS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	24942581
GO:0097011	Process	Cellular response to granulocyte macrophage colony-stimulating factor stimulus	IDA	24942581
GO:1990782	Function	Protein tyrosine kinase binding	IBA	21873635
GO:1990782	Function	Protein tyrosine kinase binding	IPI	3262426

Other IDs

• MIM: 186940
• HGNC: 1678
• e!Ensembl: ENSG00000010610

Protein

• UniProt ID: P01730
• Protein name: T-cell surface glycoprotein CD4 (T-cell surface antigen T4/Leu-3) (CD antigen CD4)
• Protein function: Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:
• PDB: 1CDH, 1CDI, 1CDJ, 1CDU, 1CDY, 1G9M, 1G9N, 1GC1, 1JL4, 1Q68, 1RZJ, 1RZK, 1WBR, 1WIO, 1WIP, 1WIQ, 2B4C, 2JKR, 2JKT, 2KLU, 2NXY, 2NXZ, 2NY0, 2NY1, 2NY2, 2NY3, 2NY4, 2NY5, 2NY6, 2QAD, 3B71, 3CD4, 3J70, 3JCB, 3JCC, 3JWD, 3JWO, 3LQA, 3O2D, 3S4S, 3S5L, 3T0E, 4H8W, 4JM2, 4P9H, 4Q6I, 4R2G, 4R4H, 4RQS, 5A7X, 5A8H
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00047	ig	24 → 123	Immunoglobulin domain	Domain
  PF05790	C2-set	125 → 203	Immunoglobulin C2-set domain	Domain
  PF09191	CD4-extracel	206 → 316	CD4, extracellular	Domain
  PF05790	C2-set	317 → 390	Immunoglobulin C2-set domain	Domain
  PF12104	Tcell_CD4_C	425 → 453	T cell CD4 receptor C terminal region	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in T-helper cells. The presence of CD4 is a hallmark of T-helper cells which are specialized in the activation and growth of cytotoxic T-cells, regulation of B cells, or activation of phagocytes. CD4 is also present in
• Sequence:

  MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIK
  ILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQL
  LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG
  TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW
  QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
  LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV
  LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV
  RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI

• Sequence length: 458

Pathways

KEGG:

Viral life cycle - HIV-1
Virion - Human immunodeficiency virus
Cytokine-cytokine receptor interaction
Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Yersinia infection
Human T-cell leukemia virus 1 infection
Human immunodeficiency virus 1 infection
PD-L1 expression and PD-1 checkpoint pathway in cancer
Primary immunodeficiency

Reactome:

Alpha-defensins
Nef Mediated CD4 Down-regulation
Binding and entry of HIV virion
Vpu mediated degradation of CD4
Downstream TCR signaling
Phosphorylation of CD3 and TCR zeta chains
Translocation of ZAP-70 to Immunological synapse
Generation of second messenger molecules
PD-1 signaling
Other interleukin signaling
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Becker muscular dystrophy	Becker Muscular Dystrophy	rs104894787, rs1569564916, rs1569546198, rs128626236, rs128626237, rs1556834513, rs2147483647, rs267606771, rs5030730, rs587776747, rs398122853, rs398123935, rs398123954, rs398123985, rs398124002, rs398124034, rs398124082, rs398124099, rs398124105, rs373286166, rs727503864, rs796065325, rs794726993, rs794727666, rs863225001, rs779739455, rs886042106, rs886042840, rs763936813, rs886044406, rs1060502639, rs1064796764, rs753662330, rs398123909, rs182575709, rs1556880354, rs1557380616, rs1557047827, rs796523999, rs886043375, rs1556875224, rs1556852444, rs1569558953, rs1569560475, rs1569563740, rs1602169535, rs1601809011, rs1603632322, rs1603636537, rs376745644	21641384
Duchenne and becker muscular dystrophy	Duchenne and Becker Muscular Dystrophy	rs794727661, rs1556930579	21641384
Duchenne muscular dystrophy	Muscular Dystrophy, Duchenne	rs128625226, rs128625227, rs128625228, rs128625229, rs2147483647, rs104894787, rs128625230, rs128626234, rs201366610, rs267606770, rs128626235, rs128626231, rs146071084, rs128626232, rs104894788, rs128626233, rs128626238, rs128626239, rs128626240, rs128626241, rs1556834513, rs128626242, rs128626243, rs128626244, rs128626245, rs128626246, rs128626247, rs128626248, rs128626249, rs128626250, rs128626251, rs128626252, rs128626253, rs128626254, rs104894790, rs104894797, rs5030730, rs1569528138, rs587776747, rs128627256, rs128627257, rs398122853, rs398123827, rs398123828, rs398123832, rs398123833, rs398123834, rs398123835, rs398123838, rs398123839, rs398123846, rs398123852, rs398123853, rs72468700, rs398123856, rs398123862, rs398123863, rs398123865, rs398123866, rs398123870, rs398123872, rs398123873, rs398123881, rs398123882, rs398123883, rs398123884, rs398123885, rs398123887, rs398123888, rs398123889, rs398123892, rs398123893, rs398123901, rs398123903, rs398123905, rs398123909, rs398123912, rs398123915, rs398123919, rs398123920, rs398123923, rs398123929, rs398123934, rs398123935, rs398123937, rs398123938, rs398123942, rs398123948, rs398123950, rs398123952, rs398123953, rs398123957, rs398123960, rs398123962, rs398123963, rs398123970, rs398123971, rs398123973, rs398123977, rs398123979, rs398123980, rs398123981, rs398123990, rs1064325, rs398123991, rs398123997, rs398123999, rs398124003, rs398124007, rs398124008, rs398124012, rs398124033, rs398124034, rs398124036, rs398124038, rs398124039, rs398124040, rs398124042, rs398124044, rs398124050, rs398124051, rs398124055, rs398124058, rs398124060, rs398124062, rs398124068, rs398124070, rs398124072, rs398124073, rs398124074, rs398124075, rs398124078, rs398124091, rs398124092, rs398124094, rs398124096, rs398124099, rs398124104, rs398124105, rs373286166, rs727503850, rs727503802, rs727503864, rs794726993, rs794727030, rs794727123, rs794727357, rs794727359, rs794727422, rs794727463, rs794727499, rs794727661, rs794727666, rs797044764, rs201361100, rs796065333, rs794727862, rs794727890, rs797045526, rs146880270, rs863224977, rs863224976, rs863224975, rs863225018, rs863225017, rs863225015, rs863225014, rs863225013, rs863225012, rs863225011, rs863225010, rs863225009, rs762394978, rs863225008, rs863225007, rs863225006, rs863225005, rs863225004, rs863225003, rs863225002, rs777864641, rs863225001, rs863225000, rs863224999, rs863224998, rs863224997, rs863224994, rs863224993, rs863224992, rs756949497, rs863224988, rs863224987, rs863224986, rs762860653, rs863224985, rs863224984, rs863224983, rs863224982, rs863224981, rs863224980, rs863224979, rs863224978, rs863224996, rs863224995, rs863224991, rs863224990, rs863224989, rs878854366, rs779739455, rs878854621, rs770845480, rs762250680, rs878854619, rs878854618, rs886039681, rs886039532, rs886039478, rs886039535, rs886039536, rs886039785, rs886041344, rs886042106, rs886042154, rs886042495, rs886042499, rs886042604, rs886042747, rs886042840, rs886042875, rs398124032, rs886042983, rs886043041, rs886043084, rs763936813, rs886043251, rs886043375, rs886043496, rs886043640, rs886043676, rs886043699, rs886043822, rs886043909, rs886043989, rs748769566, rs886044324, rs886044402, rs886044455, rs886044490, rs886044502, rs886044582, rs1057518207, rs1057518962, rs1057518692, rs1057520764, rs1556641290, rs1060502653, rs1064792968, rs1060502624, rs1060502621, rs765445866, rs1060502645, rs1064792967, rs1060502659, rs1060502620, rs1060502643, rs1060502641, rs1060502639, rs1060502636, rs1060502661, rs1060502635, rs1060502629, rs1060502644, rs72470513, rs1557079469, rs1060502626, rs1060502625, rs1060502630, rs1057524037, rs1060502633, rs1060502656, rs1060502648, rs1060502619, rs1060502646, rs1060502623, rs1060502632, rs1060502640, rs1557380496, rs1060502647, rs1060502637, rs1060502634, rs1060502615, rs1060502627, rs1557084128, rs1060502652, rs1064794569, rs1064793479, rs1064793986, rs1064793964, rs1556665303, rs753662330, rs1556790316, rs1556656184, rs1556764743, rs1556764753, rs1556806356, rs773643220, rs1556875180, rs1340365803, rs1556656851, rs1557316295, rs1556046080, rs1556256329, rs1556656487, rs1556962223, rs1556962571, rs1557011973, rs1557291170, rs1556930769, rs104894789, rs1556665052, rs1556917057, rs1557305645, rs182575709, rs1556656818, rs1557218076, rs1239018406, rs1557084067, rs1557300135, rs1556035795, rs1556037455, rs1556853039, rs1556880354, rs1557380616, rs1557047827, rs1557396600, rs1557374667, rs796523999, rs1557320151, rs1057517960, rs1557304860, rs770183212, rs1557218093, rs1557038061, rs1557320194, rs1233380601, rs1557294228, rs1557011929, rs1557322838, rs1057518284, rs1557291242, rs1557292678, rs1557322834, rs1557058415, rs1556780579, rs1556930579, rs1557369493, rs1556764934, rs1556962271, rs1557315928, rs1555998436, rs1556764922, rs1556656847, rs1557218131, rs1557369413, rs1557369991, rs1557374482, rs1055371114, rs1556040444, rs1557291229, rs1010666282, rs1556028034, rs1556929259, rs1556930839, rs1557303544, rs1557380685, rs1556802319, rs1556809704, rs1557058308, rs1557058350, rs1385794215, rs1556035817, rs1556503937, rs1556656456, rs1556764880, rs1556789913, rs1557322201, rs1557359217, rs1557362198, rs1556853298, rs1556875224, rs1556876346, rs1556852444, rs1569460607, rs1569530432, rs1569451994, rs1569452000, rs1569559106, rs144732570, rs1569273905, rs1569526122, rs1569562941, rs1569230406, rs1569559822, rs1569526579, rs1569528101, rs1569533965, rs1569546174, rs1569559110, rs1569559849, rs1569562936, rs1569562952, rs1057522454, rs149106712, rs1569469298, rs1569401103, rs1209389771, rs1569563678, rs1569560739, rs868688877, rs1569558953, rs1569230215, rs1569563751, rs1569565192, rs1569559204, rs1569186252, rs1569558906, rs1569533147, rs1569559097, rs1569564281, rs1569562466, rs1569169560, rs1429329309, rs1569460722, rs1569556943, rs1569420861, rs1569213903, rs374744331, rs1569463953, rs1569230293, rs1295394996, rs1602451773, rs1602145926, rs1602416457, rs886043597, rs1602728959, rs72466562, rs1602938385, rs1603222095, rs1603280511, rs1603452196, rs142500746, rs1254776844, rs1603513684, rs1603513697, rs1603618489, rs1603632245, rs1603632312, rs1603634298, rs1603634608, rs1603634744, rs1602169535, rs1602460062, rs1603432076, rs1603441550, rs1602766725, rs1603419076, rs1603447081, rs1603631757, rs1601809011, rs1602727611, rs1603222556, rs1602146767, rs1602337330, rs895755247, rs1602369798, rs1602409174, rs1602417503, rs1181271457, rs1602454605, rs1602454639, rs1602454747, rs1602455302, rs1602455747, rs1602456486, rs1602669026, rs1602695597, rs1602696519, rs1602730254, rs1602947628, rs1603253563, rs1601864055, rs1602056443, rs1602937974, rs1556656077, rs1603221854, rs1603222424, rs1603222574, rs1603222897, rs1603222922, rs1603223025, rs794727770, rs1603226023, rs1603264641, rs1603264659, rs1603264705, rs1603264731, rs1603280686, rs1603280745, rs1603280796, rs1603430178, rs1603430181, rs1603445277, rs1603445278, rs1603445283, rs1603445332, rs1603445344, rs1603452207, rs1603513680, rs1603513803, rs1603513817, rs1603513828, rs1603514271, rs1603514272, rs201818335, rs1603615883, rs1603628479, rs1603628482, rs1603628483, rs1603628485, rs1603628487, rs1603629988, rs1603630431, rs1603631225, rs1603631240, rs1603631241, rs1603631244, rs1603631367, rs1603631368, rs373428963, rs1603631705, rs1603631744, rs1603631752, rs1603631756, rs1603632117, rs1603632119, rs771425504, rs1216000876, rs1603632248, rs1603632309, rs1603632311, rs1603632314, rs1603632316, rs772220893, rs1603632322, rs1603632324, rs1603632326, rs1603633486, rs1603633541, rs1603633545, rs1339088514, rs398123943, rs1603633864, rs1603633868, rs1603634079, rs1569563740, rs1603634105, rs1603634199, rs1603634203, rs1603634206, rs1603634207, rs1603634299, rs1603634603, rs1603634604, rs1603634607, rs1603634609, rs747937552, rs1603634742, rs1603634743, rs1603634745, rs1603634746, rs1603634747, rs1603634748, rs1603635326, rs1603635331, rs1603635949, rs1603635950, rs1603635953, rs1603636537, rs1603636541, rs1601808288, rs1601808296, rs1601808326, rs1601808608, rs1601810667, rs1602467530, rs1602467590, rs1602467787, rs1602468968, rs1602469251, rs1602469384, rs1603137168, rs1603149954, rs1603150335, rs1603150993, rs374222301, rs1603151699, rs1603432059, rs794727863, rs1603437254, rs1603437272, rs1603441629, rs1603447057, rs1603447072, rs1602765633, rs1602766499, rs1602766531, rs1602766655, rs1403865104, rs1603419074, rs768892830, rs1603631365, rs1602765856, rs1602338283, rs1602360475, rs1603631219, rs1603634749, rs1602459252, rs2040217313, rs376745644, rs2040714340, rs2041309291, rs2044445392, rs2067953453, rs2068036881, rs2068038543, rs2078916448, rs2090513299, rs2094827204, rs2094864356, rs2095370524, rs1425702864, rs2097850041, rs2098390819, rs2042979418, rs2046036327, rs2052700227, rs2077781516, rs2080979223, rs2040711393, rs2097447247, rs2098280263, rs2098391032, rs2063781031, rs2080514041, rs2036834025, rs2063903818	21641384

Unknown
Disease term	Disease name	Evidence	References	Source
Immunodeficiency	immunodeficiency 79			GenCC

Associations from Text Mining
Disease Name	Relationship Type	References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency	Associate	18362907
Abdominal Injuries	Associate	25458969
Abortion Habitual	Associate	25935494, 39941094
Abortion Habitual	Inhibit	26345847
Achondroplasia and Swiss type agammaglobulinemia	Associate	1373352
Achondroplasia and Swiss type agammaglobulinemia	Inhibit	21488866
Acidosis	Inhibit	35708739
Acne Vulgaris	Associate	33760854
Acquired Immunodeficiency Syndrome	Associate	10102648, 10400799, 10691923, 11264355, 11581379, 11696593, 11699717, 11882044, 11967325, 12719578, 1402655, 14557639, 14722279, 14990729, 15194057, 15585654, 15795268, 16103193, 16174727, 1696717, 17038537, 17388670, 17581988, 18385244, 18510766, 18596085, 19912576, 20498045, 21396133, 23258923, 23585827, 24356113, 2572558, 26730570, 27875993, 29749506, 3091303, 3258005, 33974229, 34154423, 34320023, 35163318, 36312587, 36840494, 37161335, 7509654, 7612102, 8099857, 8586703, 8609222, 8697632, 8781430, 9028959, 9038757, 9326234, 9573232, 9573296, 9576185
Acquired Immunodeficiency Syndrome	Inhibit	16721821, 1696859, 19703245, 32591400, 33202420, 35758393, 8403502, 8450057, 9878112
Acrocephalosyndactylia	Associate	23330016, 24453425, 37499395
Acrocephalosyndactylia	Inhibit	24385687
Actinic cheilitis	Stimulate	21442435
Actinic cheilitis	Associate	25060152, 35195152
Acute Coronary Syndrome	Associate	12816883, 17919564, 18832677, 20430391, 22282196, 22711477, 23330016, 24453425, 24558424, 25484131, 25527700, 25612606, 25740578, 25997853, 26375412, 28348007, 28407684, 29211854, 29962384, 32647892, 34151742, 34313407, 37461090
Acute Coronary Syndrome	Inhibit	24385687, 24603196, 27999237
Acute Disease	Associate	23012327, 25663681
Acute Disease	Inhibit	29636753
Acute On Chronic Liver Failure	Associate	22978653, 26173605, 33613548, 34869773
Acute On Chronic Liver Failure	Stimulate	37317515
Addison Disease	Associate	16252254, 24667071
Adenocarcinoma	Stimulate	17082613, 35187162
Adenocarcinoma	Associate	19596931, 31533488, 32487090, 32562536, 34531868, 35445138, 37527282, 37532692
Adenocarcinoma Of Esophagus	Associate	36064338
Adenocarcinoma of Lung	Associate	17082613, 17668204, 26851185, 27687306, 30473538, 30816121, 31879171, 31881010, 32005679, 32556504, 32700817, 33178836, 33274216, 33461176, 33934535, 34397869, 34517904, 34531868, 35090416, 35212236, 35837383, 35844446, 35918384, 36034461, 36457341, 36572999, 37164914, 37187527, 37532692, 37694354, 38177255, 38261568, 38594917, 39175022
Adenocarcinoma of Lung	Inhibit	29440769
Adenoma	Associate	12520084
Adenoma Islet Cell	Associate	31000755
Adenomatous Polyposis Coli	Associate	32416752, 35297393
Adenomyosis	Associate	39456936
Adenoviridae Infections	Associate	27701670
Adiposis Dolorosa	Stimulate	34187516
Adrenocortical Carcinoma	Associate	34531868
Agammaglobulinemia	Associate	25926555, 31445098, 33228556, 35611411
Aggressive Periodontitis	Associate	21198753
Aicardi Goutieres syndrome	Associate	23092122
AIDS Associated Nephropathy	Associate	19397801, 23982074, 26306690, 28453847
AIDS Associated Nephropathy	Inhibit	22693541
AIDS Dementia Complex	Associate	3091303
Airway Obstruction	Associate	15944327, 16246539
Allergic Fungal Sinusitis	Associate	38441343
Alopecia	Associate	37746940, 7930677
Alopecia Areata	Associate	12125957, 27094591, 33807704
Alveolitis Extrinsic Allergic	Stimulate	10337028
Alveolitis Extrinsic Allergic	Associate	19842835, 27792269
Alzheimer Disease	Associate	23824053, 25197660, 34001857, 34804058, 35279225, 36246562, 37545529, 38301877, 39388354, 39523385, 39657893, 40560886
Alzheimer Disease	Inhibit	25072319
Amelogenesis imperfecta hypoplastic hypomaturation X linked 1	Associate	36826109
Amenorrhea	Stimulate	20065129
Amyloidosis Primary Cutaneous	Associate	9347791
Amyotrophic Lateral Sclerosis	Associate	28973548
Anal Gland Neoplasms	Associate	10195031
Anemia	Associate	25904736, 28426727
Anemia Aplastic	Associate	11544283, 14675414, 15345281, 17463169, 1827129, 21506940, 22138514, 22797698, 24528288, 24845454, 26354756, 26764034, 28831064, 30889317, 32761514, 33785863, 9160674
Anemia Aplastic	Stimulate	12404285
Anemia Hemolytic Autoimmune	Associate	10583274
Anemia Sickle Cell	Associate	32267841
Aneurysm	Associate	1700620, 30686933
Angina Stable	Associate	28260995
Angina Unstable	Associate	16799237, 24453425
Angioedemas Hereditary	Associate	12393451, 18034765
Anophthalmia with pulmonary hypoplasia	Associate	33747255
Anorexia	Associate	35586668
Anthropophobia	Associate	30941121, 33936110, 37031355, 40165131
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	12124874, 15762890, 24648606, 30157919, 30510966, 31921121, 36804380
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Inhibit	34289887
Antiphospholipid Syndrome	Associate	10643701, 11535526, 11895785, 25862984, 28193831, 30872365
Anus Neoplasms	Associate	16757590, 23900552
Aortic Aneurysm	Associate	16297165
Aortic Aneurysm Abdominal	Associate	16297165, 1700620, 29716755, 30686933, 39586133
Aortic Aneurysm Thoracic	Associate	30810667, 30957625, 37883426
Aortic Aneurysm Thoracic	Stimulate	32078016
Aortic Dissection	Associate	34202072, 39991758
Aortic Valve Disease	Associate	30810667
Aphasia Conduction	Inhibit	23667456
Arterial Occlusive Diseases	Associate	20130127
Arteriosclerosis Obliterans	Associate	35757718
Arthralgia	Associate	24223933
Arthritis	Associate	21248258, 25113810, 27849614, 29193869, 33291545, 34108969, 35130317, 38123480
Arthritis Infectious	Associate	30327490
Arthritis Juvenile	Associate	15743472, 15939793, 17374135, 18576332, 20127724, 21381000, 21702013, 21739422, 24470328, 25092890, 25833190, 26387944, 30089725, 33597588, 37445800, 37741520, 8093436
Arthritis Juvenile	Inhibit	36793127
Arthritis Psoriatic	Associate	11160357, 16277694, 24286492, 24470327, 25113810, 28245522, 29112182, 31727095, 33452865, 34108969, 34309834, 34681660, 35087513, 39711043, 39930543, 39991156
Arthritis Reactive	Associate	10640771, 15547094, 17425604
Arthritis Rheumatoid	Associate	10403931, 10513808, 10700427, 10728756, 11056676, 11207664, 11803732, 12115225, 12393721, 12428227, 12591902, 12695561, 12699431, 12847680, 12878725, 1347492, 1386608, 14726963, 15140775, 15457445, 15498047, 15535835, 15880821, 15899036, 15934068, 16200579, 16220542, 16277694, 16537805, 16838043, 17109473, 17200409, 17328044, 17565371, 17665008, 17907166, 18353171, 18512781, 19255426, 19394279, 19479869, 19843577, 19886735, 19904767, 20459811, 20465565, 20658292, 20727150, 20738421, 20824142, 20929536, 21155991, 21204897, 21314928, 22488116, 22532634, 22594821, 22649468, 23263488, 23280063, 23494522, 23619188, 24019115, 24022618, 24043759, 24313359, 24452947, 24742142, 24959711, 24968232, 25164131, 25433812, 25649145, 25738173, 25880754, 25960619, 26091715, 26147876, 26245356, 26314565, 26464634, 26604133, 27241313, 27314557, 27385284, 27434862, 27667787, 27700100, 27723282, 27915349, 28150777, 28253537, 28282368, 28535889, 28569167, 28751821, 29112182, 29193869, 29388193, 29472917, 29563614, 30106887, 30333237, 30402903, 30611306, 30753680, 30990587, 31006511, 31333666, 31338093, 31405169, 31727095, 31945409, 32111105, 32117312, 32264938, 32961930, 33117342, 33193313, 33362761, 33507149, 33799480, 34079550, 34108969, 34369364, 34580414, 34867944, 35023427, 35085847, 35523821, 35706043, 35967356, 36012570, 36062760, 36851682, 36902005, 37344505, 37809066, 37934808, 38216287, 39261837, 39290322, 39586747, 7683586, 7962553, 8621791, 8872162, 8898376, 9260157, 9301522, 9409647, 9754554, 9767455, 9826720
Arthritis Rheumatoid	Inhibit	10922071, 24223933, 30413189, 37647423
Arthritis Rheumatoid	Stimulate	14691302, 23165362, 28358698, 30052100, 31205958, 33291545, 35848477
Asbestosis	Associate	34022844
Ascites	Associate	12942579, 21203522, 30687337
Aspergillosis Allergic Bronchopulmonary	Associate	20714107
Asthma	Associate	10596698, 10691908, 11510804, 17349011, 17409322, 17460949, 18250971, 18581330, 18832695, 19152963, 19610265, 21197090, 21469087, 21473777, 23893806, 24641294, 24934276, 26276877, 27230446, 27708065, 27848966, 27902892, 29297467, 29809062, 30087444, 30537802, 30644695, 32292999, 32532832, 33271553, 34576307, 34721414, 35029177, 35817495, 36194662, 36611927, 37431194, 38129444, 39745770, 39868576, 40551049, 9657564
Asymptomatic Infections	Associate	31566584
Ataxia Telangiectasia	Associate	10606975, 11427422, 14563948, 1972177, 20448385, 23264026, 2851398, 31866622, 34248969, 38155568
Atherosclerosis	Associate	15731463, 17526997, 19406979, 20495843, 21677140, 22313962, 23469279, 24347824, 24453425, 25814626, 26383248, 26822994, 30872365, 32229536, 35428200, 35842645, 36820569, 36855107, 37881939
Atherosclerosis	Inhibit	24385687
Atrial Fibrillation	Associate	25810125, 35485359, 35600045
Atypical Squamous Cells of the Cervix	Associate	33605553, 36796230
Autism Spectrum Disorder	Associate	31591744
Autism Spectrum Disorder	Stimulate	37108638
Autoimmune Diseases	Associate	10400799, 10583274, 10739333, 11298351, 11390436, 11516335, 11602626, 11675346, 16424227, 16836768, 16917003, 17183685, 17463169, 17665008, 18000051, 18326816, 18490707, 18599794, 19074986, 19155519, 19162554, 19220836, 19283780, 19350181, 19604266, 20045101, 20370571, 20465565, 20498357, 21297967, 21508257, 21606346, 21926348, 21959269, 22461703, 22489829, 23432692, 23739916, 24376757, 24589341, 24968232, 25451162, 25556651, 25629163, 25824483, 25884400, 25894502, 26063731, 26106896, 26486970, 26764034, 27211045, 27619682, 27727279, 28150777, 28248954, 28253537, 28336414, 28393080, 28870212, 29066174, 29626493, 30632146, 31119949, 31205958, 31471951, 31612695, 31817224, 32646440, 32738192, 33128433, 33256375, 33291545, 33547171, 33893236, 34054801, 34095321, 34285924, 34605719, 35119226, 36674807, 37380713, 38054003, 39226901, 39261837, 39388354, 7635520, 7909242, 8626615, 9545531
Autoimmune Diseases	Inhibit	17615234, 19609102, 22392608, 28387597
Autoimmune Diseases	Stimulate	34631897
Autoimmune Diseases of the Nervous System	Associate	11544282
Autoimmune enteropathy	Associate	23037630
Autoimmune Lymphoproliferative Syndrome	Associate	11342444, 14592838, 17725802, 18566410, 19176318, 21183795, 24047902, 24894771, 27846610, 29686686, 31191551, 33170215, 34187243, 8642249
Autonomic Nervous System Diseases	Inhibit	25010330
Autosomal Dominant Nocturnal Frontal Lobe Epilepsy	Associate	23553139
Axial Spondyloarthritis	Associate	25688074, 30755244
Bacterial Infections	Associate	26498252, 30233588, 8760835
Bacterial Infections	Stimulate	9030883
Barrett Esophagus	Inhibit	35654816
Behcet Syndrome	Associate	10403931, 15196263, 18685727, 21959269, 22385240, 23527071, 24574333, 24887071, 25410656, 27922688, 30971748, 32756992, 33142293, 35941595, 36226612, 37093132, 39838177, 8814751, 9067527
Behcet Syndrome	Inhibit	26841832, 31614573
Berylliosis	Associate	11050177, 12438445, 12449171, 18250483, 19454729, 20299529, 24719461, 24995984
beta Thalassemia	Associate	10539886
Bicuspid Aortic Valve Disease	Associate	37883426
Bile Duct Neoplasms	Associate	35413272
Biliary Atresia	Associate	15128911, 17631149, 34918678
Biliary Tract Neoplasms	Associate	32878426
Bipolar Disorder	Stimulate	31767892
Bipolar Disorder	Associate	36676744
Birdshot Chorioretinopathy	Associate	24379648
Blastocystis Infections	Associate	37697423
Blister	Associate	15320912
Blood Coagulation Disorders	Associate	33974229
Bloom Syndrome	Associate	29098565
Bone Diseases	Associate	37809066
Bone Diseases Metabolic	Associate	29472917
Bone Marrow Diseases	Associate	15345281, 29415975
Bone Marrow Diseases	Stimulate	24833097
Brain Diseases	Associate	14691297, 15196256, 25917097, 29168181, 30305453, 37106402
Brain Diseases	Inhibit	37848421
Brain Edema	Associate	30568305
Brain Injuries	Associate	34244562
Brain Injuries Diffuse	Associate	28774302
Brain Neoplasms	Associate	32974852, 37261085, 38267913
Breast Diseases	Associate	36380012
Breast Neoplasms	Associate	11466395, 12794115, 19596912, 22471961, 22678162, 23034170, 23169287, 23778140, 25605488, 25997452, 27117582, 27707838, 27727484, 30069490, 30221739, 30670769, 31408436, 31790361, 32222891, 32562536, 32810665, 33103515, 33145341, 33623115, 33767579, 33785258, 34386013, 34518441, 34531868, 34620015, 35373393, 35486183, 35603183, 35639264, 35819135, 36189580, 36207751, 36281185, 36376974, 36437379, 36528658, 37596527, 37940345, 38170155, 38181289, 38263363, 38266804, 39175074, 39218304, 39391306, 40142285, 7929817
Breast Neoplasms	Inhibit	34365471
Bronchiectasis	Associate	28054583, 9828857
Bronchiolitis	Associate	24116927, 28257632, 31901157, 36561744
Bronchiolitis Obliterans Syndrome	Stimulate	11698307
Bronchiolitis Obliterans Syndrome	Associate	14604970, 14764530, 17889354, 18617642, 19505389, 21900196, 23607447, 25266000, 25460358, 26717145, 29197137, 30936059, 32382059, 33965183
Bronchiolitis Obliterans Syndrome	Inhibit	15972448, 20628341
Bronchopulmonary Dysplasia	Associate	25797206, 37507442
Brucellosis	Associate	20404074
Bruton type agammaglobulinemia	Associate	11877289, 22289994, 34489944
Burkitt Lymphoma	Associate	12133989, 17521425, 20876453, 22162713, 24628049, 34668039, 7595225, 8695856
Burkitt Lymphoma	Inhibit	34668039
Bursitis	Associate	36875119
Buruli Ulcer	Associate	28241036
Calcinosis Cutis	Associate	17724589
Cancer Pain	Associate	14770079
Candidiasis	Associate	1720301
Capillary Leak Syndrome	Associate	9400611
Carcinogenesis	Associate	24519063, 33941222, 36864443
Carcinoma Adenoid Cystic	Associate	22382400
Carcinoma Basal Cell	Associate	27117439, 33623115
Carcinoma Ductal	Associate	22471961, 35776197
Carcinoma Hepatocellular	Associate	14716821, 15633209, 17372588, 17457217, 18793383, 20087354, 20686664, 20883314, 21419713, 22505239, 23223899, 23526963, 25907075, 26517519, 27136203, 29670256, 30116751, 31485637, 31903159, 32075608, 32170378, 32218692, 32626741, 32863381, 32945410, 33264420, 33426064, 33441885, 34221187, 34405225, 34424809, 34531868, 34769191, 34813686, 34980144, 35092558, 35123420, 35189839, 35321724, 35363194, 35833147, 35986302, 36211805, 36221095, 36536232, 36746728, 36938729, 37077908, 37089050, 37335078, 37371463, 37400463, 37881434, 39289669, 39738479, 39838375, 40410708, 7927492
Carcinoma Hepatocellular	Inhibit	15180734
Carcinoma in Situ	Associate	40010639
Carcinoma Intraductal Noninfiltrating	Associate	26249178, 32203210
Carcinoma Large Cell	Associate	36263183
Carcinoma Neuroendocrine	Associate	37027114
Carcinoma Non Small Cell Lung	Associate	14611679, 16421594, 20473949, 23098499, 24136748, 24761885, 25967708, 27000869, 27191652, 27244531, 27323163, 28187172, 28624781, 29991058, 30123214, 30505306, 31043415, 33385734, 33676448, 34603645, 35122478, 35131864, 35523765, 35831288, 36159860, 36281084, 36588094, 37402763, 37648263, 38062068, 39692573, 39870014
Carcinoma Non Small Cell Lung	Inhibit	29767245
Carcinoma Ovarian Epithelial	Associate	19673890, 21829534, 22454499, 30485902, 31221207, 33914317, 35449092
Carcinoma Pancreatic Ductal	Associate	24746181, 24797069, 25827621, 28898495, 33777046, 35655709, 35836806, 35987606, 36512410, 40410886
Carcinoma Papillary	Stimulate	39299443
Carcinoma Renal Cell	Associate	10431690, 10944605, 12208877, 18004564, 19001137, 19238009, 19454729, 19609102, 1968360, 21300979, 25563193, 25824786, 30534127, 31431691, 32469992, 33322496, 33429832, 33619294, 34290908, 34402193, 34531868, 34795663, 36463235, 36611966, 36712923, 36793506, 38292868, 39348357, 9328129
Carcinoma Renal Cell	Stimulate	32277125
Carcinoma Renal Cell	Inhibit	33177244
Carcinoma Signet Ring Cell	Associate	36921674
Carcinoma Squamous Cell	Associate	12716470, 19596931, 21200385, 22402444, 25340823, 31881010, 34531868, 35195152, 35799269, 36703911, 36966704, 37164914, 37177979, 37415224, 9119748
Carcinoma Squamous Cell	Stimulate	19220831, 20473949
Carcinoma Transitional Cell	Associate	19623656
Carcinosarcoma	Associate	34876047
Cardiomyopathies	Associate	22774985, 28543170
Cardiomyopathy Dilated	Associate	19397801, 27974462, 28207945, 37967839
Cardiomyopathy infantile histiocytoid	Associate	8627751
Cardiomyopathy Restrictive	Associate	34489963
Cardiovascular Diseases	Associate	30157919, 31275310, 32229536, 35292700, 37166484, 40649979
Cardiovascular Diseases	Stimulate	34360781
Carney Complex	Associate	37151356
Carotid Stenosis	Associate	33480285, 36304068, 37644056
Carrington syndrome	Associate	7489791
Cartilage Diseases	Associate	27241313
Castleman Disease	Associate	37175521
Cataplexy	Inhibit	17665008
Cataract	Associate	24785834
CD59 Deficiency	Associate	16277694, 26870823, 33836874
CD8 Deficiency Familial	Associate	21546492
Celiac Disease	Associate	10784586, 12324465, 17307878, 19351412, 22785229, 23326425, 23571506, 23874626, 23878218, 24968232, 26838051, 28049849, 28166225, 28283419, 29191561, 31457091, 31628754, 3261663, 33057065, 33654213, 33927210, 33927715, 34495570, 34618841, 34895167, 34960101, 35119226, 35371081, 35995787, 38415552
Celiac Disease	Inhibit	25465638
Central Nervous System Diseases	Associate	23409198, 24282598, 2783859
Cerebral Infarction	Associate	27884769, 32344922, 35962388
Cerebrovascular Disorders	Associate	37459093
Chagas Cardiomyopathy	Associate	17635814, 29160519, 29473686
Chagas Disease	Associate	22774985, 28543170, 29160519
Charcot Marie Tooth disease Type 2B	Associate	36453923
Chemical and Drug Induced Liver Injury	Associate	10209518, 23305119, 25786446, 28257599
Chemke Oliver Mallek syndrome	Associate	29039547
Chlamydia Infections	Associate	29287991
Cholangiocarcinoma	Associate	39359389, 40410708
Cholangitis Sclerosing	Associate	24726754, 28597951, 37256725, 38199298
Chondrosarcoma	Stimulate	33095470
Chondrosarcoma Extraskeletal Myxoid	Stimulate	26104913
Chorioamnionitis	Associate	25797206, 27870827, 31912179
Choroidal Effusions	Stimulate	18925324
Choroidal Effusions	Associate	9099924
Chromosome 6 ring syndrome	Associate	10203105
Chromosome Deletion	Associate	39891996
Chronic Disease	Associate	19394279, 22647666, 23012327, 23508476, 24136005, 24935928, 30700717, 37863732
Chronic Kidney Disease Mineral and Bone Disorder	Associate	25484131
Chronic Periodontitis	Associate	1834575
Chronic Urticaria	Associate	32899053, 33801296, 35371000, 36713372
Churg Strauss Syndrome	Associate	20729468, 21484763
Clear cell metastatic renal cell carcinoma	Associate	11862476, 36396738
Cleft Lip	Associate	25139022
Coagulation Protein Disorders	Associate	14521599
Cognition Disorders	Associate	19220836, 39657893
Cognitive Dysfunction	Associate	37373554
Coinfection	Associate	11211316, 24520951, 32229536, 32937024
Coinfection	Stimulate	17957262
Colitis	Associate	11298351, 20465565, 35707543, 39210005
Colitis	Inhibit	23695510, 9743220
Colitis Ulcerative	Associate	12699425, 1889695, 19292766, 19318319, 25144293, 25386078, 25526204, 26333292, 26345973, 26522261, 26589955, 28453768, 29512372, 31191543, 31206576, 31330513, 31356607, 32210709, 32908909, 33907256, 35876170, 36746519, 37055495, 37273534, 37788725, 39586377
Colitis Ulcerative	Inhibit	17602351, 9743220
Colitis Ulcerative	Stimulate	9071939, 9329971, 9824577
Colonic Neoplasms	Associate	22319577, 30013992, 35445138, 37370088, 37626132, 37770581
Colorectal Neoplasms	Associate	10602890, 12695859, 14612896, 14968119, 17122624, 17510400, 21179245, 22276195, 22408358, 2365056, 23955802, 24064667, 24833093, 25268580, 25445815, 27110571, 27619682, 27682874, 28210081, 29020986, 29992127, 30013992, 31351430, 31354723, 31488881, 31921188, 32571262, 33101776, 33229508, 33413474, 33818637, 33868236, 34357372, 34717544, 34938284, 35127345, 35262923, 35292828, 35321516, 36063748, 36633318, 37483596, 37800782, 38364976, 38415552, 38583239, 39508845, 40001057, 40069612, 40274385, 40312697
Colorectal Neoplasms	Inhibit	33625532
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	29710228
Common Variable Immunodeficiency	Associate	10403927, 11876763, 14616794, 16412063, 17223965, 17302902, 19162554, 23039891, 23432692, 25225461, 25295286, 25926555, 26684629, 28054583, 29083052, 31445098, 32174910, 32575504, 3289139, 33193371, 34247288, 35305035, 38129593, 8666443, 9367399
Common Variable Immunodeficiency	Inhibit	12165093, 1638763, 24130688, 29345621, 37086677, 8100719
Communicable Diseases	Associate	10330445, 11516335, 18256187, 19040613, 21059769, 28705256, 32873094
Condylomata Acuminata	Associate	37053156
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	29517683
Conjunctivitis Allergic	Associate	24368924, 25999672, 33114004, 36272417
Coronary Aneurysm	Associate	10331508, 17919564, 24419807
Coronary Artery Disease	Inhibit	11882051
Coronary Artery Disease	Associate	18832677, 21889313, 22645426, 25001165, 35776197, 36077273, 36865544, 40508061
Coronary Disease	Associate	18832677, 35478415, 36060667
Coronary Disease	Stimulate	24167372
Coronary Restenosis	Associate	37325628
Cough	Inhibit	27383318
Cough	Associate	34719421
COVID 19	Associate	32217834, 32217835, 32307550, 32405080, 32492530, 32574309, 32592406, 32598880, 32644266, 32679621, 32864865, 32866033, 32983106, 33096020, 33128792, 33178207, 33178221, 33193384, 33220925, 33237528, 33473155, 33692788, 33717140, 33741750, 33905951, 33937096, 33945513, 33993490, 34157486, 34427670, 34619994, 34764490, 34895167, 34965282, 35011632, 35090598, 35114198, 35154116, 35237272, 35336918, 35364330, 35398299, 35567391, 35663467, 35670811, 35675811, 35741107, 35764965, 35842705, 35880744, 35911689, 35980979, 36217141, 36232381, 36305225, 36414950, 36420584, 36562254, 36814840, 36855103, 37222960, 37302069, 37358499, 37483627, 37730638, 37762093, 37848421, 38077321, 39205152, 39205185, 39337460, 39355257, 39497098, 39510135, 40190436, 40299994
COVID 19	Inhibit	32425950, 32950268, 33041191, 33154753, 33677468, 34392110, 34716309, 34838183, 35698744, 36197228, 36946852, 39679195
COVID 19	Stimulate	35688805, 35851312, 36102684, 36430210
Craniocerebral Trauma	Inhibit	12174361
Craniopharyngioma	Associate	36091021
Crazy paving pattern	Associate	36029220
Critical Illness	Inhibit	33041191
Critical Illness	Associate	37965255
Crohn Disease	Associate	11709514, 12699425, 15020649, 15306587, 15306590, 16045746, 19289577, 19318319, 20298123, 2101599, 22128034, 22167015, 23232296, 24681654, 24935928, 25761185, 27267052, 29453928, 29489879, 31158273, 31191543, 31968593, 33298614, 33313682, 35760777, 36746519, 37280154, 37550393, 37586415, 37752523, 38090774, 38211712, 9060820, 9071939, 9329971, 9422543
Crohn Disease	Stimulate	23695510
Crohn Disease	Inhibit	9743220
Cryptococcosis	Associate	26871820, 35720334
Cystic Disease Of Lung	Associate	10504398
Cystic Fibrosis	Associate	24911279, 25803862
Cystitis Interstitial	Associate	34399738, 35589692, 40435311
Cytokine Release Syndrome	Associate	16585607, 18373702, 22235276, 24585897, 34344350, 37373554, 37794597, 39281206
Cytomegalovirus Infections	Associate	11559831, 12010789, 12149221, 12662301, 12759463, 14645006, 17158960, 17183685, 17328033, 17553885, 18173357, 18454861, 18471037, 19539220, 20034645, 20562332, 21115690, 21526194, 22182806, 22539948, 22865914, 23258923, 23777765, 24130889, 24148296, 24465619, 24594993, 25008818, 25275464, 25974183, 26603521, 27460884, 27606804, 27821506, 28338007, 28683106, 28972094, 29491459, 30157919, 32229536, 32891157, 33301425, 33597150, 36865544, 37086677, 38512581, 38642678, 40004169, 7708976
Cytomegalovirus Infections	Inhibit	19747638
Cytomegalovirus Infections	Stimulate	31019052
Cytomegalovirus Retinitis	Associate	18173357
Dacryocystitis	Associate	27358392
Death	Associate	1402655, 15503313, 18456875, 19040613, 20663947, 21789236, 24646462, 27016692, 31401307, 33362757, 34154423, 35740993, 36555549
Death	Inhibit	21200385
Death	Stimulate	35287794
deficiency of adenosine deaminase 2	Associate	36248833
Deltaretrovirus Infections	Associate	1370929, 23409198, 27282836, 29723784, 39339919
Dementia	Associate	15890908
Dental Plaque	Associate	16799237
Depressive Disorder	Associate	15361220, 23110234
Depressive Disorder	Inhibit	18276105
Depressive Disorder Major	Associate	33112414, 37086677, 37327287
Dermatitis Allergic Contact	Associate	12060402, 19657353, 31148973
Dermatitis Atopic	Associate	11069080, 11511293, 11720173, 16354184, 16484990, 16782037, 1714926, 18007580, 19439349, 22686584, 22968402, 26288354, 27448748, 29703987, 31511620, 33093567, 33807704, 35576187, 35743308, 37330465
Dermatitis Atopic	Stimulate	31205958
Dermatitis Atopic	Inhibit	39196303
Dermatitis Atopic 1	Associate	12653839, 21197090
Dermatomycoses	Associate	37128909
Dermatomyositis	Associate	15829578, 19953283, 24441329, 29172719, 29494763, 30157932, 33413573, 33675790, 35711463, 35762881, 35799782
Dermatomyositis	Stimulate	19949654
Diabetes Gestational	Inhibit	36203592
Diabetes Gestational	Associate	36513052
Diabetes Mellitus	Stimulate	17526997
Diabetes Mellitus	Associate	31995625, 35154512, 35727147, 36077273, 36600150, 36865544, 37773841, 38408622, 8700877
Diabetes Mellitus Insulin Dependent 7	Stimulate	34346755
Diabetes Mellitus Type 1	Associate	15030582, 15182254, 15358643, 15667574, 16030184, 16260488, 1696864, 17032246, 17206281, 18248531, 18803760, 19037920, 19180473, 19654878, 19875613, 20045101, 20498357, 21896932, 22332874, 23390544, 24239002, 24348676, 24376757, 24523574, 24968232, 24973447, 25421756, 25523632, 25652388, 25682896, 26518356, 26631741, 26714416, 26888215, 27181214, 27629486, 28024918, 28248954, 28566371, 28645874, 29176645, 29229565, 29791073, 30619245, 30650147, 30723474, 31110501, 31511930, 32060144, 32248243, 32878069, 34127860, 35007320, 35022272, 35142878, 35626661, 36169248, 36201618, 36477008, 37040399, 37309552, 37432736, 37751304, 8082309, 9294207
Diabetes Mellitus Type 1	Stimulate	17100770, 23915345, 3280182
Diabetes Mellitus Type 1	Inhibit	24677179, 31299986
Diabetes Mellitus Type 2	Associate	17526997, 27459386, 29107298, 29752628, 30044774, 30270447, 36940958, 36945068, 40080435
Diabetes Mellitus Type 2	Stimulate	25363329, 30574794
Diabetes Mellitus Type 2	Inhibit	30652669
Diabetic Angiopathies	Associate	11369787, 27606804
Diabetic Nephropathies	Associate	34506229
Diabetic Retinopathy	Inhibit	39290701
Diabetic Retinopathy	Associate	40214234
Dianzani autoimmune lymphoproliferative syndrome	Associate	24894771, 31191551
Diarrhea	Associate	22873400, 35398299, 35586668
Diffuse panbronchiolitis	Associate	9030883
DiGeorge Syndrome	Associate	19040613, 21323691, 31297990, 31322747, 37006241
DiGeorge Syndrome	Inhibit	20141355, 30949166
Disease	Associate	10601054, 10759761, 12942579, 15864353, 1828397, 19737237, 22471282, 25421756, 26444573, 31839959
Disease	Stimulate	11119267, 3261663
Disease Progression	Stimulate	32203221
Disease Progression	Associate	37349318
Disease Resistance	Associate	24422906, 25889017
Disseminated Intravascular Coagulation	Associate	23037630
Dissociative Identity Disorder	Stimulate	22808957
Down Syndrome	Associate	22861363, 31699819
Down Syndrome	Inhibit	35222360
Drug Hypersensitivity	Associate	1373352, 16354184, 17349011, 19657353, 20635785, 24116013, 24338253, 24391521, 25093709, 33114004, 33662368, 34673799, 38203472, 38441343, 9241767, 9378492, 9714417
Drug Hypersensitivity	Inhibit	22092655, 34257142
Drug Related Side Effects and Adverse Reactions	Associate	10780664, 1713198, 18832677, 20686664, 23302373, 25484131, 26870823, 27136203, 27324616, 27606804, 28331088, 29476109, 29669829, 30842324, 31250942, 31417563, 32382059, 32497499, 35007320, 36171010, 37161048, 39210005, 7474110, 8095828, 9767455, 9920842
Drug Related Side Effects and Adverse Reactions	Stimulate	29027667
Drug Resistant Epilepsy	Associate	23782115, 24164431, 26584666, 27061881, 29244809, 31266818, 31479466, 32183889, 32692778, 33478415, 34622550, 35917929, 37327289, 40253369
Duane Retraction Syndrome	Associate	32183889, 33855355
Duodenal Ulcer	Associate	12738386, 15618192
Dysbiosis	Associate	30171206, 33707430
Dysentery	Associate	28854225
Dysentery Bacillary	Associate	8991634
Dyserythropoiesis Congenital with Internuclear Chromatin Bridges and Ultrastructurally Normal Erythroblast Heterochromatin	Associate	10691859
Dysferlinopathy	Associate	19949654, 26045819
Dyskeratosis Congenita	Associate	32452087
Dyskinesia Drug Induced	Associate	40495522
Dyskinesia Familial with Facial Myokymia	Stimulate	21079332
Dysplastic Nevus Syndrome	Associate	34919260
Dyspnea	Associate	36197228
Dystonic Disorders	Stimulate	32416752
Ectodermal Dysplasia Anhidrotic with Immunodeficiency Osteopetrosis and Lymphedema	Associate	35479072
Ectrodactyly cardiopathy dysmorphism	Associate	29396927
Eczema	Associate	22092655, 24116927
Embolism	Inhibit	27084711
Emphysema	Associate	24805101, 30335480, 33936110
Encephalitis	Associate	17060473, 31332390, 32109548, 32744608
Encephalitis Tick Borne	Associate	31924650
Encephalomyelitis	Associate	34215689
Encephalomyelitis Autoimmune Experimental	Associate	21281812
Endometrial Neoplasms	Associate	25931171, 28300844, 32066405, 32339157, 35693634, 36207751, 36581331, 36881401
Endometriosis	Associate	25275597, 30325236, 31615517, 31941945, 37081668
Endometritis	Associate	34671363
Endotoxemia	Associate	25225461
Enterobacteriaceae Infections	Associate	33275070
Enterocolitis	Associate	22267598
Enterocolitis Necrotizing	Associate	31801814
Enteropathy Associated T Cell Lymphoma	Associate	22654438, 26474755
Eosinophilia	Associate	16219537, 17166416, 32849632, 8642249
Eosinophilic Esophagitis	Associate	37699081
Ependymoma	Associate	19917695
Epidermodysplasia Verruciformis	Associate	35202881
Epilepsy Generalized	Associate	40495522
Epilepsy Post Traumatic	Associate	8100745
Epilepsy Temporal Lobe	Associate	32744608
Epilepsy Tonic Clonic	Associate	36104359
Epstein Barr Virus Infections	Associate	10864684, 11504544, 14694109, 1672270, 23442890, 23569328, 34882759, 35215762, 35315593, 38078808, 7909607, 8995705
Epstein Barr Virus Infections	Stimulate	31205958
Erosive Adenomatosis of the Nipple	Associate	18489537
Erythema Infectiosum	Associate	28358698
Erythema Nodosum	Associate	28991896
Escherichia coli Infections	Associate	22403314
Esophageal Neoplasms	Associate	23082063, 27577071, 38065897, 40587482
Esophageal Squamous Cell Carcinoma	Associate	23889244, 28949934, 32317292, 34616847
Essential Hypertension	Associate	36891527
Evans Syndrome	Associate	34424963
Exanthema	Associate	20646339
Factor 8 deficiency acquired	Associate	12911593
Familial Mediterranean Fever	Associate	15544632
Familial Primary Pulmonary Hypertension	Associate	33478117, 36555549, 36899621
Fanconi Anemia	Associate	28557197
Fatigue	Associate	35586668
Fatigue Syndrome Chronic	Stimulate	21619669, 27001659
Fatigue Syndrome Chronic	Associate	23514202, 26032326, 26370228, 39394558
Fatigue Syndrome Chronic	Inhibit	29867995
Fatty Liver	Associate	26806136
Febrile Neutropenia	Inhibit	15503313
Fever	Associate	33128792
Fibrolamellar hepatocellular carcinoma	Associate	36302754
Fibromyalgia	Associate	32582603
Fibrosis	Inhibit	18726940
Fibrosis	Associate	20462651, 20883314, 22252758, 23446058, 26754349, 28054583, 28376292, 33912168, 35364330, 35903097, 37002627, 39276679
Fibrous Dysplasia Polyostotic	Associate	28827283, 29850635, 30585624
Folate Malabsorption Hereditary	Stimulate	15322179
Food Hypersensitivity	Associate	24762976, 30120223
Fractures Closed	Inhibit	28591184
Frailty	Associate	32187205, 37254268
Frontotemporal Dementia	Associate	23891730
Frontotemporal Lobar Degeneration	Associate	35060553
Gallbladder Neoplasms	Associate	34185421
Gastritis	Associate	27306341, 32974219, 34589088, 38366919, 9784570
Gastrointestinal Neoplasms	Associate	12942579, 26516200
Gastroschisis	Associate	31145102
GATA2 Deficiency	Associate	11328295, 12548603, 15054822, 15832009, 33526873, 35523765
Gaucher Disease	Associate	10389595, 15916690
Gaucher Disease	Inhibit	27855396
general anxiety disorder	Associate	38264647
Genetic Diseases Inborn	Associate	12174361
Genetic Diseases Inborn	Inhibit	33471124
Geographic Atrophy	Associate	38165703
Germinoma	Associate	36259639
Germinoma	Stimulate	39958339
Gerodermia osteodysplastica	Associate	25309050
Giant Cell Arteritis	Associate	14672892, 22147555, 30037347, 31379838, 34583923, 35003111, 37435729, 37952293, 39436725, 40095634, 8113687
Giant Cell Tumor of Bone	Stimulate	33095470
Gingivitis	Associate	34234776
Glioblastoma	Associate	16723631, 1848799, 18490770, 19028999, 22937035, 24570975, 25555571, 26578623, 28412740, 28880903, 30299157, 30568305, 31451090, 33449451, 34531868, 35599254, 35969754, 35994815, 38057698, 39513882
Glioma	Associate	17066899, 17216339, 1836455, 18577234, 24375192, 24691423, 26578623, 28620836, 31690954, 33140187, 34531868, 35720326, 35812432, 36325335, 36714574
Glioma of Brain Familial	Associate	34531868
Gliosarcoma	Associate	34876047
Gliosis	Associate	32744608
Glomerulonephritis	Associate	20506525
Glomerulonephritis IGA	Stimulate	1982451, 20484297
Glomerulonephritis IGA	Associate	32085673, 34823491, 35351150, 35528619, 37752523, 7908616, 7996808
Glomerulonephritis IGA	Inhibit	36059518
Glomerulonephritis Membranous	Associate	15954921, 37974210
Glomerulosclerosis Focal Segmental	Associate	33059348
Glucose Intolerance	Associate	30941121, 37711619
Glucosephosphate Dehydrogenase Deficiency	Associate	25793728
Glut1 Deficiency Syndrome	Stimulate	37431194
Glutathione Peroxidase Deficiency Hemolytic Anemia possibly due to	Associate	8288627
Glycogen Storage Disease 0 Muscle	Associate	10539886
Glycogen Storage Disease Type II	Associate	28389590
Glycogen Storage Disease Type IV	Inhibit	33267869
Glycogen Storage Disease Type IV	Associate	9472657
Glycosuria Renal	Associate	34289887
Gout	Associate	36550178
Graft vs Host Disease	Associate	10516610, 12946996, 15284108, 15327522, 15459005, 16038781, 16443514, 16681643, 19505389, 20302964, 21835147, 25300871, 25543092, 26327693, 27812545, 28746369, 30894856, 31205958, 33133081, 34657151, 35015822, 36056390, 36071219, 7670118, 8063938
Graft vs Host Disease	Stimulate	12780786, 16792671, 33226726
Graft vs Host Disease	Inhibit	19912254, 23226545, 24859877
Granuloma	Associate	12000723, 24177566, 32744608, 33720848
Granuloma Annulare	Associate	12060389
Granulomatosis with Polyangiitis	Associate	11562512, 11678911, 12000723, 12716450, 14764530, 15147365, 16837919, 16918819, 20113371, 21484763, 22490506, 28615072, 35039330, 37086441, 9764612
Granulomatosis with Polyangiitis	Stimulate	28040323, 36613701
Granulomatous Disease Chronic	Associate	8881751
Graves Disease	Associate	10780664, 15147360, 19240157, 22216337, 24478186, 25940130, 29259988, 2962792, 30938833, 31554206, 33980771, 34616359, 35220890, 35720300, 39388354, 7900942, 8025214, 9545531, 9546811
Graves Disease	Inhibit	23249428, 27206624
Graves Disease	Stimulate	30956992, 33987447, 40155866
Graves Ophthalmopathy	Associate	10781517, 15148216, 27349268, 28485799, 29974826, 32176314, 38536014, 39234250, 39689341
Graves Ophthalmopathy	Stimulate	19419934
Graves Ophthalmopathy	Inhibit	37875358
HAIR AN syndrome	Associate	29992171, 30996137
Hamartoma Syndrome Multiple	Inhibit	27477328
Hand Foot and Mouth Disease	Associate	24939221
Hand Foot Syndrome	Associate	35586668
Hantavirus Pulmonary Syndrome	Associate	9400611
Harlequin type ichthyosis	Associate	34614112
Hashimoto Disease	Inhibit	21147625, 23249428, 27206624
Hashimoto Disease	Associate	24478186, 25940130, 39508448
Hashimoto Disease	Stimulate	35720300, 7994911
Head and Neck Neoplasms	Associate	20857101, 28945296, 7790320
Heart Arrest	Associate	36930329
Heart Defects Congenital	Associate	39281206
Heart Diseases	Associate	17635814, 18617642, 22574131, 29160519, 29473686, 30379878, 38116006
Heart Failure	Associate	18037740, 20462651, 25984539, 34857156, 36555549, 37390254
Heart Failure	Inhibit	21935395
Heart Failure	Stimulate	28838148
Heart Valve Diseases	Associate	23417848, 28143491
Hematologic Diseases	Associate	10583274
Hematologic Neoplasms	Associate	12483012, 29122757, 36341566, 40028321
Hemoglobinuria Paroxysmal	Associate	15086421
Hemolytic Uremic Syndrome	Associate	15730400
Hemolytic Uremic Syndrome	Stimulate	19406979
Hemophilia A	Associate	18034765, 29444872, 36936969
Hemophilia B	Stimulate	10354153
Hemorrhage	Associate	36855107
Hepatic Encephalopathy	Associate	28751644, 36293192
Hepatitis Alcoholic	Associate	31494259
Hepatitis Autoimmune	Associate	28597951, 29358858, 30600293, 31422415, 36159854, 36841352, 37290592
Hepatitis B	Associate	23032418, 24672661, 25786446, 26173605, 28591184, 34177894, 35458518, 36635631
Hepatitis B	Inhibit	28231294
Hepatitis B Chronic	Associate	15996036, 22978653, 28606013
Hepatitis B Chronic	Inhibit	28231294
Hepatitis C	Associate	15865084, 17034579, 17601623, 20710056, 24465502, 24489961, 24760894, 29120899, 31952232, 32750098, 33912168, 34930041, 36405960, 9227171
Hepatitis C	Stimulate	22671952, 23555014
Hepatitis C	Inhibit	27183178, 34474121
Hepatitis C Chronic	Associate	24130824, 32994477, 33912168
Hepatitis Viral Human	Stimulate	10858179
Hepatitis Viral Human	Associate	37207191
Hepatomegaly	Associate	26684629
Hereditary Autoinflammatory Diseases	Associate	20498355
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30206415, 33367520
Hereditary leiomyomatosis and renal cell cancer	Associate	18684866, 20876453, 26722524, 28893733, 9710220
Heredodegenerative Disorders Nervous System	Associate	15136590, 15864353, 18190256
Herpes Simplex	Stimulate	17957262
Herpes Simplex	Associate	28201724
Herpes Zoster	Associate	24352459, 35720399
Hidradenitis Suppurativa	Associate	27206704
Histiocytosis Langerhans Cell	Associate	3280696
HIV Infections	Associate	10193417, 10200305, 10361239, 10375528, 10419894, 10444267, 10447730, 10469055, 10556193, 10559275, 10607709, 10671214, 10693824, 10775581, 10910888, 11023494, 11032864, 11086107, 11122240, 11437669, 11495299, 11529919, 11544282, 11559831, 11566623, 11604406, 11699717, 11734634, 11861282, 11882044, 11982603, 11986255, 12059946, 12200381, 12218162, 12402403, 12409732, 12434018, 12522039, 12534962, 12709027, 12730375, 12931750, 12970422, 12974761, 1349271, 1371493, 14632751, 1475186, 14764521, 14963124, 1501285, 15059846, 15067030, 15173593, 15194057, 15252446, 15271794, 15373912, 15457680, 15527839, 15542635, 15705786, 15753288, 15864345, 15892963, 15905189, 15980151, 15987650, 16011533, 16046522, 16246391, 16260021, 16421946, 16505369, 1671082, 16796525, 16928758, 16935861, 17005693, 17005700, 17035326, 17051525, 1706342, 17065205, 17092330, 1709701, 17110377, 17147468, 17182676, 17229711, 17257057, 17263642, 17465678, 17474134, 17688698, 17709553, 17928354, 17957262, 18025239, 18036256, 18372341, 18376407, 18379725, 18414671, 18454861, 18484654, 18490721, 18550667, 18617991, 18684102, 18692772, 18821942, 18845823, 18928553, 18941536, 18981766, 19005268, 19131896, 19165342, 19178925, 19182922, 19194312, 19239367, 19251297, 19295330, 19299747, 19303366, 19381272, 19390419, 19406689, 19432547, 19723616, 19797156, 19918060, 19952713, 20001317, 20132229, 20147631, 20162549, 20186035, 20299954, 20433405, 20656923, 20660788, 20710056, 20715931, 20847379, 20862322, 20926955, 21059891, 21111238, 21115690, 21118300, 21124822, 21171992, 21257970, 21298072, 21343147, 21347267, 21352200, 21403397, 21410942, 21494598, 21526194, 21592997, 21666058, 21690402, 21740673, 21819256, 21840929, 21902583, 21912648, 21940422, 2200889, 22027639, 22044858, 22114342, 22141397, 22156200, 22166560, 22182806, 22205964, 22215422, 22240256, 22287716, 22312424, 22313962, 22319447, 22345473, 22359615, 22363505, 22378925, 22398371, 22400042, 22438246, 22444912, 22457278, 22470433, 22471284, 22676378, 22687513, 22715399, 22735071, 22739389, 22768122, 22792231, 22808957, 22866663, 22921314, 23029209, 23029309, 23032418, 23092122, 23129528, 23171203, 23185351, 23242319, 23254284, 23258923, 23382191, 23382678, 23392455, 23442890, 23516360, 23520522, 23566249, 23585827, 23588134, 23614015, 23635305, 23637601, 23658518, 23707169, 23721325, 23724012, 23782115, 23806696, 2384919, 23884411, 23931628, 23965471, 24005375, 24047762, 24091694, 24284880, 24304582, 24335483, 24356113, 24378728, 24422906, 24465619, 24483185, 24497824, 24497828, 24498878, 24499954, 24520951, 24522925, 24554663, 24558379, 24585897, 24661998, 2470786, 24722454, 24752012, 24759207, 24785834, 24785950, 24797997, 24828336, 24829350, 24834865, 24871455, 24875931, 24942581, 24947188, 24961156, 25053368, 2511174, 25193656, 25197078, 25314253, 25329064, 25333710, 25495598, 25611551, 2564677, 25647167, 2572607, 25786446, 25808800, 25809693, 25859596, 25924764, 25974183, 26018157, 26068923, 26178998, 26291824, 26339043, 26402620, 26452480, 26559763, 26584215, 26627102, 26650393, 26666875, 26676775, 26678998, 26696749, 26754349, 26762145, 26764036, 26776123, 26807971, 26842474, 26842479, 26854806, 26883727, 26889036, 26927799, 26939770, 26962229, 27073222, 27082643, 27082982, 27124305, 27145859, 27163710, 27183178, 27191978, 27280548, 27281071, 27384654, 27401039, 27415008, 27506421, 27509243, 27525551, 27531931, 27536983, 27630231, 27795436, 27821902, 2783372, 27865749, 27870882, 27875993, 27898686, 27932619, 27981723, 27986677, 27992415, 28031466, 28076376, 28077629, 28077659, 28132517, 28181541, 28222782, 28225449, 28299915, 28331180, 28338007, 28484257, 28486838, 28509877, 28539453, 28591184, 28604824, 28615199, 28698276, 28744024, 28857825, 28892135, 28972094, 29029206, 29048352, 29115572, 29246111, 29367348, 29474461, 2950525, 29518102, 29538651, 29577368, 29636753, 29643247, 29652923, 29746296, 29800425, 29867928, 29915583, 29992171, 30005016, 30053296, 30063722, 30157873, 30171206, 30193823, 30197641, 30198299, 30285810, 30320604, 30344003, 30355686, 30379878, 3047430, 30522500, 30653393, 30662943, 30700725, 30735686, 30809229, 30857592, 30914509, 30917149, 30921390, 30936293, 30941121, 30979916, 30996137, 31107306, 31118081, 31118290, 31189571, 31208153, 31270222, 31277610, 31308388, 31396221, 31415590, 31440240, 31475647, 31497018, 31511383, 31511615, 31519219, 31533030, 31536177, 31550271, 31552706, 31593126, 31772057, 31781094, 31796951, 32019634, 32029589, 32093678, 32161179, 32196533, 32229536, 32241262, 32268275, 32282853, 32295609, 32295913, 32305135, 32350074, 32353080, 32379159, 32496542, 32579550, 32654992, 32750098, 32762760, 32828803, 32899621, 32907975, 32946499, 32954948, 33007050, 33073673, 33166790, 33310773, 33322496, 33477692, 33587445, 33605553, 33643305, 33720048, 33757177, 33776993, 33832435, 33867524, 33952659, 33974229, 33976386, 34017335, 34037423, 34076482, 34149690, 34237254, 34249000, 34320023, 34344350, 34370780, 34389623, 34425224, 34449812, 34465136, 34614112, 34618690, 34672108, 34712231, 34844430, 34845066, 34858437, 34870928, 34896288, 34938286, 34987521, 35042816, 35081977, 35106507, 35258402, 35412343, 35418589, 35429609, 35458559, 35499323, 35738253, 35787792, 35880744, 35941737, 35967422, 36150362, 36361228, 36380676, 36411423, 36443691, 36462403, 36536105, 36569851, 36599978, 36693889, 36820829, 36971588, 37030290, 37216549, 37430239, 37824079, 37949879, 38049910, 38067117, 38226493, 38267841, 39224595, 39466061, 39690095, 40003876, 40061947, 40149968, 7474129, 7500020, 7539037, 7570415, 7587726, 7587741, 7738172, 7851009, 7902137, 7907956, 8082291, 8099857, 8103715, 8137540, 8171003, 8603515, 8675212, 8697632, 8806559, 8906753, 8911139, 8918576, 8946943, 9010252, 9045868, 9056736, 9104824, 9108384, 9119998, 9144377, 9223523, 9226175, 9272912, 9326655, 9353145, 9421482, 9427713, 9454752, 9472655, 9472657, 9501224, 9547340, 9733846, 9878112, 9920850, 9929359
HIV Infections	Inhibit	10403921, 11069080, 11390619, 11800643, 12097565, 12121440, 12738771, 1402655, 15297312, 16632604, 1696859, 1700829, 17511038, 18974880, 19076827, 19912576, 19956090, 20208540, 20498045, 20520721, 21653240, 21859712, 21943198, 22134167, 22162758, 22310831, 22371879, 22726303, 24098454, 24348678, 24886575, 24985081, 25137293, 25423108, 26730570, 27281059, 27881646, 28125732, 28241075, 29563914, 30682089, 31043532, 31208015, 32098821, 32567004, 32591400, 32711474, 33093334, 34608862, 34753817, 37697423, 39230302, 7554447, 7586671, 7586672, 8450057, 9605996, 9787145
HIV Infections	Stimulate	11095734, 1373086, 22671952, 26671450, 32508833, 9714415
HIV Seropositivity	Associate	1351431, 19703245, 20715931, 30157919
Hodgkin Disease	Associate	12116341, 16757686, 17158640, 17644739, 18362907, 18502823, 26084540, 2675617, 27312067, 2965930, 29880615, 32589698, 34506624, 34615710, 35111387, 37933048, 7518195, 7573367
Hodgkin Disease	Stimulate	18956470
Hodgkin Disease	Inhibit	34584203
HTLV I Infections	Inhibit	10102648, 14557656, 25081935, 31190065
HTLV I Infections	Associate	10447738, 11435401, 11698284, 11886260, 12805437, 12970439, 1438212, 14990729, 15367641, 15857992, 16425996, 1702159, 17320923, 17483473, 17609262, 17942534, 17956580, 18077723, 18596085, 1885736, 19300495, 19457989, 19570853, 19587052, 19663693, 19913863, 19917610, 19949656, 2144349, 23284797, 24517971, 2479771, 25148903, 2541442, 26358743, 26683952, 27434587, 27875993, 31142734, 33837058, 36214569, 7860769, 7884855, 8095306, 8516299, 8556497, 8807058, 8892896, 9499799, 9729533, 9733871, 9765450
HTLV II Infections	Associate	17035326
Huntington Disease	Stimulate	34802797
Hyper IgM Immunodeficiency Syndrome	Associate	15086393
Hypereosinophilic Syndrome	Associate	10886202, 11298328, 11559946, 16219537, 19608752, 23642304, 25398061, 25682606, 32849632, 39788434, 8608231, 8642249
Hyperglycemia	Associate	17526997
Hyperglycemia	Stimulate	25894202
Hyperinsulinism	Inhibit	30983877
Hyperkinesis	Associate	27902892
Hyperplasia	Associate	24116927, 29105795, 9824577
Hypersensitivity	Associate	11511310, 37074725
Hypersensitivity Delayed	Associate	1373352
Hypersensitivity Immediate	Associate	27764137
Hypertension	Associate	27765883, 29388859, 33196557, 35586668
Hypertension Portal	Associate	34930041
Hypertension Pregnancy Induced	Inhibit	12623476, 29846432
Hypertension Pulmonary	Associate	20973920, 31141166, 37731513
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	24774748, 26005050
Hypophosphatemic Rickets Autosomal Dominant	Associate	9389727
Hypothyroidism	Stimulate	40155866
Hypotrichosis	Associate	16489183
Hypoxia	Associate	10539886, 10880747, 34194423
Hypoxia	Stimulate	24931519
Hypoxia Brain	Stimulate	24931519, 37910505
Idiopathic Noncirrhotic Portal Hypertension	Associate	34930041
Idiopathic Pulmonary Fibrosis	Stimulate	10337028
Idiopathic Pulmonary Fibrosis	Associate	20126467, 22037258, 23262513, 28754682, 31694639, 32320626, 33386384, 36871016, 37266442, 37544465, 39205185, 39289672, 39510135
Idiopathic subglottic tracheal stenosis	Stimulate	32557663
IgA Vasculitis	Associate	10728756, 12699431, 13130466, 15661933, 18635598, 20929536, 23494522, 24022618, 26491701, 27769184, 2964958, 2972426, 34517873, 39924084, 7763112
Ige Responsiveness Atopic	Associate	24589341
Immune Dysregulation Polyendocrinopathy Enteropathy X Linked Syndrome	Associate	14597756, 16990602, 18489537, 19155519
Immune Reconstitution Inflammatory Syndrome	Associate	20660788, 22431997, 26611774, 29538651, 30728405, 31190065
Immune Reconstitution Inflammatory Syndrome	Stimulate	25492918
Immune System Diseases	Associate	12942579, 1373086, 1683740, 19923460, 21257970, 22837194, 23152910, 28940416, 31545490, 33193371, 34938286, 35618845, 35935994
Immune System Diseases	Inhibit	20196868, 30996137, 31398453, 36380676
Immunoblastic Lymphadenopathy	Associate	11337383, 3046680, 7902143
Immunoglobulin a deficiency 1	Stimulate	3289139
Immunoglobulin G4 Related Disease	Associate	27358392, 29434340, 29499100, 31856905, 36609529, 36831337, 37561593, 37762039, 38077321
Immunoglobulin G4 Related Disease	Stimulate	29039547
Immunologic Deficiency Syndromes	Associate	11678896, 1380169, 20470401, 23658782, 25329064, 2564677, 27525551, 27902892, 31189571, 33073673, 33256375, 35163318, 35237272, 39735996, 9826720
Immunologic Deficiency Syndromes	Inhibit	38112969
Indifference to Pain Congenital Autosomal Recessive	Associate	40241002
Infections	Associate	10559349, 10749578, 10864687, 11119612, 11287575, 11312658, 11696593, 11861835, 11902332, 12072498, 12374807, 12504566, 12552096, 12781713, 12857927, 14568977, 14632751, 15173593, 15194768, 15618192, 15650227, 15879023, 15890908, 15916792, 16393985, 16792668, 16928758, 17005693, 1702842, 17158230, 17312174, 17362263, 17507486, 17670831, 17889354, 17942534, 18178833, 18508887, 18798835, 18827929, 19019953, 19129457, 19165342, 19178925, 1931229, 19447460, 19535453, 19557157, 19698128, 19781520, 19838123, 20001317, 20147895, 20186035, 20222966, 21068257, 21628534, 21642597, 21828275, 21992606, 22166560, 2243398, 22615999, 22719887, 22740584, 2293663, 23029309, 23138836, 23209780, 23264589, 23365642, 23721325, 23791644, 24116927, 24837770, 25008921, 25423108, 25555152, 25797607, 26020637, 26275199, 26539983, 26559763, 26671450, 27466424, 28122636, 28148784, 28199704, 28892135, 28956765, 29118121, 29167762, 29287991, 29511683, 29661652, 30415390, 30477583, 30768357, 30842324, 30870532, 31127857, 31826842, 31857499, 32198428, 32348459, 32598880, 32762760, 32873094, 32886726, 33031103, 33166790, 33399535, 33835029, 34343169, 34346755, 34571855, 34616406, 34753817, 34882759, 34931886, 35011632, 35090598, 35112366, 35165387, 35215762, 35744023, 36229577, 36536105, 37030290, 37225706, 37408049, 37655880, 40284913, 7558138, 7699322, 7769729, 8094041, 8411372, 8461467, 8630388, 8995671, 9151834, 9218830, 9378492
Infections	Inhibit	16935861, 1871120, 1991165, 2144349, 24156513, 26730570, 27124899, 28591184, 34399785, 3548405, 36560637, 7474110, 9242540, 9787145
Infections	Stimulate	23822699, 30559208, 37161335
Infectious Mononucleosis	Associate	12594286, 1672270, 23569328, 2527653, 34882759, 8329707, 9158095
Inferior Wall Myocardial Infarction	Associate	24969587
Infertility	Associate	36603467
Inflammation	Associate	10596698, 10691908, 11050177, 11510804, 11511310, 14997933, 15128911, 15148216, 15661933, 15743472, 16782037, 16792668, 17483473, 17635814, 17828272, 17975675, 1831490, 18550855, 18684844, 19152963, 19208087, 19283780, 19480659, 19734235, 19904767, 20840654, 21397857, 21448265, 21606346, 21739422, 21917308, 22147555, 22157983, 22307621, 22313962, 22539948, 22633193, 22711477, 22965858, 23305119, 23818545, 24121758, 24136005, 24313359, 24338253, 24368924, 24391521, 24395888, 24441329, 24585897, 24641294, 24959711, 24960164, 25004830, 25198707, 25269704, 25309050, 25341640, 25375131, 25451162, 25484131, 25797206, 25824483, 25827621, 25884400, 25978359, 26385705, 26387944, 27124305, 27183178, 27377073, 27468819, 27708065, 27821506, 28241075, 28426727, 28453768, 28485799, 28502089, 28640942, 29066026, 29725326, 30218032, 30231065, 30232328, 30329194, 30389786, 30402903, 30537802, 30700717, 30759186, 30894863, 31145102, 31145753, 31440043, 31653682, 31909418, 32111105, 32300208, 32423044, 32532832, 32639582, 32647892, 32744608, 32766167, 32914944, 32974219, 32977850, 33196557, 33296081, 33298584, 33402994, 33426088, 33482899, 33552054, 33601057, 33717140, 33817728, 33902571, 34108969, 34113337, 34289887, 34589088, 34737186, 34755133, 34895167, 35015822, 35029177, 35219585, 35364330, 35385700, 35398299, 35485359, 35663467, 35805941, 35980979, 36180106, 36462403, 36499121, 36945068, 37088297, 37106402, 37225706, 37256725, 37373554, 37586415, 37600767, 37620910, 37809066, 37856221, 37918715, 37952293, 38009648, 38043109, 38207130, 38211712, 38412094, 39226901, 39769168, 40190436, 7500031, 8025072, 8113687, 9738953
Inflammation	Inhibit	26962942, 28387597, 36505477
Inflammation	Stimulate	30123214, 31316519
Inflammatory Bowel Diseases	Associate	11298349, 15020649, 18330941, 18422560, 21147109, 21376048, 22158873, 22965858, 25978359, 28164626, 29547621, 31417161, 32016358, 32547537, 32598439, 34108969, 34224909, 34673799, 36167345, 36437465, 36746519, 37063924, 37124046, 37600767, 37752523, 39343250, 39586377, 9422543
Inflammatory Bowel Diseases	Stimulate	27001939
Inflammatory Breast Neoplasms	Associate	31145753, 35705026
Inflammatory Breast Neoplasms	Inhibit	33267869
Influenza Human	Associate	10954576, 15196256, 18781564, 21353149, 22314361, 22554464, 22715399, 26094691, 26489873, 27402904, 27571776, 29800425, 30692574, 33310880, 33976217, 34343169, 34795301, 35670811
Influenza Human	Stimulate	27821506, 30573748, 30619245
Insulin Like Growth Factor I Deficiency	Associate	25890304
Internal Hernia	Associate	38003629
Intervertebral Disc Degeneration	Associate	34858418, 36193061
Intestinal Diseases	Inhibit	22228968
Intestinal Diseases	Associate	28854225
Intestinal Perforation	Associate	36825028
Intracranial Aneurysm	Associate	35833148
Invasive Pneumococcal Disease Recurrent Isolated 2	Associate	1440463, 34389623
Invasive Pulmonary Aspergillosis	Associate	24747947
Iris hypoplasia and glaucoma	Associate	34508765
Irritable Bowel Syndrome	Associate	37648784
Job Syndrome	Associate	12067309, 22118528, 37916874
Kartagener Syndrome	Associate	31533488
Keratitis Herpetic	Associate	11069987
Keratoacanthoma	Stimulate	29799076
Kidney Diseases	Associate	20977632, 26603521, 27413076, 31535918, 34531868
Kidney Failure Chronic	Associate	11737371, 24189710, 25484131, 27460884, 27957330, 28858434
Kidney Neoplasms	Associate	31855296, 34030645, 37657842
Laryngeal Neoplasms	Stimulate	27180957
Laryngotracheal Stenosis Progressive with Short Stature and Arthropathy	Stimulate	32557663
Latent Autoimmune Diabetes in Adults	Associate	26839444, 28396876
Latent Autoimmune Diabetes in Adults	Inhibit	27357431
Latent Tuberculosis	Associate	25520147
Lead Poisoning Nervous System	Associate	10998137
Legg Calve Perthes Disease	Inhibit	38139422
Leishmaniasis	Associate	25139022
Leishmaniasis Cutaneous	Associate	25139022, 33793565
Leishmaniasis Visceral	Associate	25200768, 35106507, 38416647
Leprosy	Associate	16339528, 18424702, 22002092, 22205964, 23936569, 24214631, 25672298, 7524076
Leprosy	Stimulate	19618084
Leprosy Lepromatous	Associate	24214631, 24454972, 30642265
Leprosy Multibacillary	Associate	9822276
Leprosy Tuberculoid	Inhibit	22002092
Leprosy Tuberculoid	Associate	25470342, 3257577
Leptospirosis	Associate	26491036
Leukemia	Associate	10458772, 10845931, 12393705, 15070688, 15295005, 15845894, 15958635, 16569594, 16585953, 18227839, 18316730, 20113470, 2070082, 20820776, 21205081, 21310823, 2195543, 22647666, 22753942, 2296082, 24741612, 25629163, 25815345, 26474588, 2783859, 2846089, 29805109, 30619360, 32812702, 35210405, 35255120, 35820057, 36010641, 36179686, 8611704, 8652829, 8896419, 8995603, 9485189, 9716596
Leukemia	Stimulate	20801903
Leukemia Acute X Linked	Associate	22875869
Leukemia B Cell	Associate	10864684, 32174910, 33421548
Leukemia Hairy Cell	Associate	20687201, 23347903, 7911341
Leukemia Large Granular Lymphocytic	Associate	12139733, 12875995, 17303697, 18768393, 19251297, 20448385, 2302461, 28441377, 31866622, 35210405, 8822933
Leukemia Lymphocytic Chronic B Cell	Associate	10068672, 10419899, 11678896, 11981828, 12393705, 14615377, 15536147, 15965501, 1680497, 17019687, 19895614, 20081380, 20562332, 21455998, 21523729, 21904560, 22101351, 22842611, 23300177, 23807677, 24166938, 25286418, 26140546, 26478573, 27369070, 27927767, 29276179, 29925389, 30336122, 32581054, 33421548, 35193595, 35511436, 36826109, 37824808, 7909242, 9074413, 9596676, 9766799
Leukemia Lymphocytic Chronic B Cell	Inhibit	12780786, 15138491, 2459562
Leukemia Lymphoma Adult T Cell	Associate	10845931, 11838588, 1373087, 15009733, 16108835, 16585963, 20222966, 21205081, 21300980, 22647666, 24041428, 24363428, 25519886, 26552867, 26683952, 29444188, 30518541, 31642546, 35315593, 36851682, 36997002, 8390425, 9233579
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	10419896, 18316730, 19706888, 20470401, 21269567, 28049640, 29805109, 29925907
Leukemia Myelogenous Chronic BCR ABL Positive	Inhibit	9259585
Leukemia Myeloid	Associate	15958635, 17005036, 19903675, 28807569
Leukemia Myeloid Acute	Associate	12010820, 12483012, 15388576, 22592607, 22879624, 24741612, 24757092, 24961348, 25400771, 27821506, 2783859, 29843224, 29908544, 29922294, 32456622, 33054115, 33957373, 34011073, 34555853, 34845035, 34913594, 35820057, 35924580, 36081495, 36477735, 36960073, 37288810, 37759316, 7579404, 9002966, 9920842
Leukemia Plasma Cell	Associate	24715427
Leukemia Prolymphocytic	Associate	1680497
Leukemia Prolymphocytic	Inhibit	1742486
Leukemia Prolymphocytic T Cell	Associate	10403909, 11122109, 21463298, 21985361, 31412798, 3486061
Leukemia Promyelocytic Acute	Associate	8095167
Leukemia T Cell	Associate	14984494, 16371020, 17891925, 18417567, 19734979, 23025755, 23759068, 8100486
Leukemia T Cell	Inhibit	27565576
Leukemic Infiltration	Associate	39201715
Leukoencephalopathies	Associate	36796230
Leukoencephalopathy Progressive Multifocal	Associate	22549384
Leukopenia	Associate	35586668
Lichen Planus	Associate	1430362
Lichen Planus Oral	Associate	18782324, 26594049, 27383402, 30329194, 31792433, 33544810, 34670484, 36397025, 37808434, 39369184
Lichen Sclerosus et Atrophicus	Associate	11891200
Lichenoid Eruptions	Associate	36397025
Limbic Encephalitis	Associate	34841709
Linitis Plastica	Associate	36703611
Lipedema	Associate	37108757
Liposarcoma	Associate	34465597
Liver Cirrhosis	Associate	23840511, 30740944
Liver Cirrhosis Biliary	Associate	20638239, 21735469, 23681290, 24116927, 25042122, 25627620, 27631617, 28425483, 30600293, 35309298, 7851017, 9545531
Liver Diseases	Associate	15634930, 25953611, 29281718, 33386815
Liver Failure	Associate	36635631, 37327339
Liver Failure Acute	Associate	16937439, 29229400
Liver Failure Acute	Inhibit	21605420
Loeys Dietz Syndrome	Associate	23884466
Long QT Syndrome	Associate	30644704
Lown Ganong Levine Syndrome	Stimulate	33475152
Lung Diseases	Associate	15730402, 18241227, 24116927, 34867961, 35364330, 7586671
Lung Diseases	Inhibit	40190436
Lung Diseases Interstitial	Associate	12827664, 16287509, 22288596, 27145754, 29172719, 32162841, 33298584, 33413573, 35250976, 37535195, 37898737
Lung Injury	Stimulate	27230446
Lung Injury	Associate	32801053
Lung Neoplasms	Associate	11970966, 16585607, 18064389, 20565977, 21681373, 24244422, 24761885, 25325779, 27692344, 28253320, 31043415, 31066485, 33859531, 34048945, 34137173, 36219677, 37580655, 38007577, 40157887
Lung Neoplasms	Inhibit	28187172
Lupus Erythematosus Cutaneous	Associate	17530636, 32082077
Lupus Erythematosus Discoid	Stimulate	35979531
Lupus Erythematosus Systemic	Associate	10430616, 10508246, 11315925, 11352243, 12568118, 14872508, 15004168, 15147571, 15476242, 15498047, 15547095, 16606650, 16802356, 16879242, 17277168, 17665008, 17947713, 18194272, 18311820, 18451510, 18505426, 18505436, 18576316, 18641361, 18668553, 18800986, 19155519, 19289577, 19520616, 19815495, 19841178, 19843090, 20131288, 20506525, 20589076, 20625494, 21110900, 21192791, 21436623, 21538319, 21708033, 21959034, 22235999, 22549474, 22549634, 22621248, 22835828, 23019580, 23434382, 23623029, 23913957, 23915345, 23950730, 23962407, 24047902, 24082908, 24391825, 24463447, 24495300, 24500400, 25070893, 25454068, 26005050, 26055806, 26079624, 26209442, 26453305, 26582197, 26764034, 27065298, 27111767, 27156107, 27424138, 27600584, 27737517, 27852285, 27915349, 28430662, 28793932, 28973837, 29018507, 29066026, 30009168, 30315781, 30662367, 30962246, 31331400, 31354747, 31412880, 31431691, 31514450, 31536480, 31653682, 31781109, 31808546, 31848026, 33007439, 33176801, 33329581, 33562078, 33670902, 33882880, 34079550, 34149710, 34256772, 34890161, 34899718, 34940981, 35172900, 35762881, 35940821, 36075396, 36180106, 36314527, 36351407, 36499016, 36536372, 36703979, 36748375, 36781170, 36815949, 37072752, 37114204, 37179450, 37400575, 37586763, 38078808, 39333474, 39375179, 39388354, 7531628, 8403494, 9716112
Lupus Erythematosus Systemic	Inhibit	14871297, 16423064, 19173720, 26076826, 30988119, 32718891, 35130317, 8100746, 8918566
Lupus Erythematosus Systemic	Stimulate	20334681, 24774748, 32317002, 33475152
Lupus Nephritis	Associate	12568118, 16879242, 19021013, 20213807, 21635228, 24475019, 24774748, 27156107, 31331400, 31536480, 31685786, 33277543, 34081342, 36430418
Lupus Vasculitis Central Nervous System	Associate	14764530
Lyme Disease	Associate	11005833, 23450683, 37471146
Lymphadenitis	Associate	26763360
Lymphangiectasis Intestinal	Associate	38022535
Lymphangiectasis Intestinal	Inhibit	9862365
Lymphatic Abnormalities	Associate	38022535
Lymphatic Metastasis	Associate	23826668, 24870595, 36980192, 37270478, 38263363
Lymphedema	Stimulate	37108757
Lymphocytic Choriomeningitis	Associate	21900169
Lymphocytosis	Stimulate	10908151, 31310589
Lymphocytosis	Associate	12875995, 17303697, 28441377, 7890378
Lymphohistiocytosis Hemophagocytic	Associate	27925643, 37401643
Lymphoma	Associate	10803703, 12095642, 14592815, 16410445, 17388670, 17615291, 17891925, 18227839, 19443664, 20176801, 21274672, 21904560, 22647666, 23025755, 25628470, 26464657, 27193732, 27980301, 28885361, 2943330, 30237271, 3120822, 33202420, 35895386, 7678256
Lymphoma AIDS Related	Associate	39324141
Lymphoma B Cell	Associate	10540330, 19443664, 19509224, 21463298, 21538319, 21854084, 22174855, 25568348, 25595783, 26464657, 28732145
Lymphoma B Cell	Stimulate	26084540
Lymphoma B Cell Marginal Zone	Associate	27306341, 32963045
Lymphoma Extranodal NK T Cell	Associate	26497849
Lymphoma Follicular	Associate	10540330, 18814264, 21270444, 22015774, 23775959, 25700246, 29293620, 30784598, 33133070, 34267181, 35030632, 35687817, 39248131
Lymphoma Large B Cell Diffuse	Associate	23670212, 24833097, 27709793, 28192480, 28537908, 32079690, 34422089, 35983077, 37234150, 37801226, 38099311, 38531803, 39665214
Lymphoma Large B Cell Diffuse	Inhibit	26355571, 35401516
Lymphoma Large Cell Anaplastic	Associate	10886202, 30206415, 9347791
Lymphoma Non Hodgkin	Associate	10540330, 17615291, 19606255, 23302373, 26084540, 27605551, 30659053, 34539622, 35789341, 36649311, 36826995
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	23368872
Lymphoma Primary Effusion	Associate	18166773, 22234686, 27893813
Lymphoma T Cell	Associate	10861691, 1380169, 16219537, 18311111, 1831409, 21079332, 2118401, 21881587, 24499954, 2546634, 25619965, 26268241, 27105079, 27312067, 2943330, 29517683, 31645398, 35523507, 36325319
Lymphoma T Cell Cutaneous	Associate	10433941, 10886511, 10910922, 11121132, 11564173, 12200382, 15514008, 15816832, 17340017, 17401465, 18684941, 19505389, 19626037, 20107729, 20713771, 21191411, 24151865, 24523507, 2527911, 27929746, 28625481, 29895574, 32760603, 34220814, 34608214, 35947128, 38326614, 7706773, 8721488, 9596682, 9717967
Lymphoma T Cell Cutaneous	Stimulate	10504451
Lymphoma T Cell Peripheral	Associate	23037630, 24618604, 2469701, 27312067, 27861791, 34980830, 36544095, 37933048, 9488618
Lymphomatoid Papulosis	Associate	9347791
Lymphopenia	Associate	10606975, 11737070, 12121441, 12204949, 16038781, 17034579, 18456875, 21209878, 21257970, 21494598, 22476911, 25205547, 25604093, 26246517, 31639143, 31714901, 32217834, 33228556, 33362779, 33912168, 35316209, 36174772, 36197228, 37408049, 38139422, 38441205, 39224595, 8609222, 9008288, 9664084
Lymphopenia	Inhibit	31781092, 32427393, 37279717, 37848421
Lymphopenic Hypergammaglobulinemia Antibody Deficiency Autoimmune Hemolytic Anemia and Glomerulonephritis	Associate	10403927, 17935071, 26459150, 27821506
Lymphoproliferative Disorders	Associate	10864684, 11509608, 12437636, 15691277, 29517683, 31558678, 33965183, 35523507
Lysosomal Storage Diseases	Associate	24463447
Macrophage Activation Syndrome	Associate	25467409, 25797607
Macular Degeneration	Associate	28377586, 29132135, 39547643
Macular Degeneration	Stimulate	35352887
Malaria	Associate	19877016, 25646355, 26173100, 32983106
Malaria Falciparum	Inhibit	23295747
Malnutrition	Associate	17362263
Malocclusion Angle Class II	Associate	30644704
Marfan Syndrome	Associate	22479353
Mastocytosis Systemic	Associate	32174910, 36759849
Measles	Associate	22532682, 27251754
Megalencephalic leukoencephalopathy with subcortical cysts	Associate	32508833
Melanoma	Associate	10049939, 10049951, 10330445, 10618430, 10684854, 11259659, 11742496, 12794170, 14770079, 15085202, 16799335, 1712819, 18343923, 18414854, 18606658, 18941742, 19435913, 19581576, 19651643, 19779716, 20547105, 20696919, 21397857, 21690475, 21903207, 22371843, 22400038, 22454499, 23935194, 24396833, 24756419, 26245876, 26608910, 26641258, 27094152, 28640942, 29360643, 29895674, 30123214, 31275310, 31630873, 32210968, 32246006, 33031392, 33785258, 33820810, 34220837, 35189004, 35383113, 35508657, 37418389, 37466381, 37466668, 37505479, 39210005, 40226614, 7923247, 8101473, 9182821
Melanoma	Inhibit	29546435, 37170241
Melanoma Cutaneous Malignant	Associate	34047683, 34531868
MELAS Syndrome	Associate	38499449
Melorheostosis	Inhibit	34187516
Meningioma	Associate	25400783, 40441235
Meningioma	Inhibit	25609200
Meningitis Cryptococcal	Associate	23493728
Meningitis Fungal	Inhibit	36946852
Mental Retardation X Linked 94	Associate	20735940
Mesothelioma	Associate	30245692
Metabolic Side Effects of Drugs and Substances	Associate	9151834
Metabolic Syndrome	Associate	36865544
Methylmalonic Aciduria due to Methylmalonyl CoA Mutase Deficiency	Inhibit	27799384
Microsatellite Instability	Associate	30894409
Microscopic Polyangiitis	Associate	39672520
Milk Hypersensitivity	Associate	12138061
Mitochondrial Diseases	Associate	11739707, 30320604, 31707363, 36462403
Monoclonal Gammopathy of Undetermined Significance	Stimulate	16150935
Monoclonal Gammopathy of Undetermined Significance	Associate	21904560
Mood Disorders	Inhibit	18276105
Motor Disorders	Associate	23054369
Motor Neuron Disease	Associate	11439170
Mouth Diseases	Associate	12412747, 25275597, 28193831, 32063460, 33007050
Mouth Neoplasms	Associate	36086675
Movement Disorders	Associate	28754092, 29168181, 32744608
Moyamoya Disease	Associate	31532776
Mpox (monkeypox)	Inhibit	36356606
Mucinoses	Associate	38013542
Mucocutaneous Lymph Node Syndrome	Associate	12653853, 18070150, 22645426, 33188570, 33622252, 35222381, 35755167, 35924269, 7851022, 9486410, 9790317
Mucocutaneous Lymph Node Syndrome	Inhibit	38357816
Mucopolysaccharidosis III	Associate	33514545
Mucor infection	Associate	36305225
Mucositis	Associate	22156200, 29511683, 34589088
Mulibrey Nanism	Associate	33042106
Multiple Myeloma	Associate	14717778, 15578069, 16150935, 16410445, 18071334, 18156498, 1832993, 20568250, 20651070, 21030562, 21904560, 22666318, 23152910, 23232072, 25099367, 29511683, 33488620, 34502204, 35222688, 36105747, 36982802, 37815499, 38574299, 39175948, 8605346, 9504626, 9504628
Multiple Myeloma	Inhibit	15750834, 33013907
Multiple Sclerosis	Associate	10193428, 10736102, 11602626, 15048733, 16547138, 17897326, 18156204, 18378324, 18727631, 18769633, 19016907, 19740340, 19740385, 20065129, 20148420, 20174631, 20661655, 21067621, 21079332, 21281812, 21300823, 21427490, 21653833, 21810280, 22182694, 22768094, 22837658, 23039885, 23202893, 23638056, 24282598, 24376757, 24453076, 24659064, 24852325, 25738751, 25938517, 26203907, 26829210, 26849221, 27162345, 27424664, 27438997, 27570566, 27626663, 28155899, 28301515, 28729889, 29168181, 29290406, 30173916, 30305453, 30379917, 30698680, 30759186, 30848579, 31024521, 31427643, 31566584, 31581595, 31968593, 32328067, 32375811, 32518073, 32817525, 33037101, 33091337, 33112414, 33158438, 33222687, 33354282, 33529846, 34006899, 34251726, 34285924, 34561436, 34643957, 34873174, 35266286, 35479072, 35672799, 35693770, 35868128, 36341423, 37106402, 37506490, 37824079, 38009648, 8197142, 8901604, 9119974
Multiple Sclerosis	Inhibit	29295981
Multiple Sclerosis Chronic Progressive	Associate	30770703
Multiple Sclerosis Relapsing Remitting	Associate	16412055, 17897326, 20148420, 24901013, 25261476, 26095162, 28729889, 28766461, 31167379, 31180553, 33354282, 33529846, 35022272, 35328606
Multiple Sclerosis Relapsing Remitting	Stimulate	23611040
Muscle Neoplasms	Associate	19692168, 36194662
Muscular Atrophy	Inhibit	30977974
Muscular dystrophy congenital with central nervous system involvement	Associate	10331508
Muscular Dystrophy Duchenne	Associate	20382434
Myalgia	Associate	32896291
Myasthenia Gravis	Associate	10525041, 11785677, 14575152, 15049785, 15454488, 16585608, 17323412, 23110942, 26347149, 32243615, 33136553, 35265719, 35979348, 38325197, 40525756, 8094093, 8827715, 9737677, 9867130
Myasthenia Gravis Autoimmune Experimental	Associate	15454488, 17323412
Mycobacterium avium intracellulare Infection	Associate	9657559
Mycobacterium Infections	Associate	33296702
Mycobacterium Infections Nontuberculous	Associate	10779786, 11211316, 15273814
Mycoses	Associate	30644704
Mycosis Fungoides	Associate	10504456, 1828937, 1987296, 19935642, 21148332, 22722467, 25044837, 25158034, 2527911, 28206666, 28441377, 30770361, 35406628, 35642346, 36428999
Mycosis Fungoides	Stimulate	38013542
Myelodysplastic Syndromes	Associate	12358908, 12404285, 20647647, 21097671, 23453286, 33570632, 34631897
Myelodysplastic Syndromes	Inhibit	27036031, 31705171
Myeloproliferative Disorder Chronic with Eosinophilia	Associate	30816121
Myeloproliferative Syndrome Transient	Associate	11966768
Myocardial Infarction	Associate	19394279, 19843577, 22426168, 23330016, 24453425, 26375412, 28260995, 34857156, 37798364, 40685440
Myocarditis	Associate	28018858, 37382257
Myopathies Structural Congenital	Associate	25141905
Myositis	Associate	27936488, 35371068, 39946176, 9008283
Myositis Inclusion Body	Associate	24594700, 35131904
Myotonic Dystrophy	Inhibit	26095067, 33287713
Myotonic Dystrophy	Associate	34830017, 35727147
Mysophobia	Associate	22031506, 25225461, 28241075
Narcolepsy	Associate	17665008, 27821550, 33837283
Narcolepsy 1	Associate	28107375, 31048269, 37380713
Nasal Polyps	Associate	19250527, 20515572, 25269704, 26239551, 27468819, 36466903
Nasal Polyps	Stimulate	19639723
Nasopharyngeal Carcinoma	Associate	14694109, 17262084, 18297191, 19220831, 22226739, 31574860
Necrosis	Associate	11967324, 18596085
Neonatal herpes	Associate	28007920
Neoplasm Metastasis	Associate	12045238, 25119597, 26317902, 27110571, 27323163, 28210081, 28841418, 29390966, 29757775, 29774030, 33308232, 34229299, 34808386, 35189004, 35296750, 35383113, 36980192, 37261085, 38062230, 39838423
Neoplasm Metastasis	Stimulate	24519063
Neoplasm Metastasis	Inhibit	28038471, 36915210
Neoplasms	Associate	10049939, 10049951, 10233901, 10330445, 10361224, 10540330, 10682684, 10864684, 10886511, 10944605, 11337383, 11342451, 11466395, 11564173, 11591807, 11742496, 11862476, 12010820, 12021307, 12045238, 12208877, 12357321, 12483012, 12536238, 12538712, 12682787, 12794170, 12853579, 12942579, 1353365, 14583468, 14611679, 14612896, 14635058, 14738463, 14738769, 14770079, 14968119, 1501285, 15085202, 15197261, 15388576, 15600300, 15618192, 15790789, 15832009, 1631166, 16362412, 16367922, 16489049, 16723631, 16775224, 16778109, 16836768, 16947022, 16984392, 16998465, 17063124, 17068154, 17109473, 17183685, 17186289, 17235436, 17508019, 17724589, 17947658, 18004564, 18156498, 18221909, 1828937, 18307280, 18326821, 1836455, 18413766, 18414854, 18424733, 18606658, 18658027, 18751426, 18761663, 18818309, 18820132, 18923710, 18925324, 19238009, 19289577, 19380765, 19557412, 19581576, 19596912, 19685052, 19692168, 19707583, 19798410, 19812686, 19883432, 19917695, 2007247, 20179673, 20231613, 20460488, 20473949, 20547105, 20549821, 20661468, 20686664, 20696919, 20734397, 20857101, 21048114, 21059769, 21079332, 21200385, 21300980, 2137847, 2147109, 21569810, 21630107, 21681373, 21705450, 21825174, 21858191, 21903207, 21930068, 22187279, 22226739, 22234686, 22252752, 22252753, 22319577, 22371843, 22506556, 22507318, 22555974, 22585562, 22592607, 23025755, 23251433, 23302373, 23526963, 23603862, 23681603, 23836412, 23935194, 23958949, 23977174, 2398528, 24064667, 24110741, 24122851, 24127572, 24136748, 24244422, 24244610, 24396833, 24512329, 24691423, 24764581, 24812403, 24862743, 24894090, 24952243, 25445815, 25550807, 25593302, 25605488, 25611283, 25713363, 2574630, 25779340, 25791067, 25931171, 25993655, 26042612, 26081906, 26249178, 26280204, 26317902, 26460798, 26461054, 26516200, 26517519, 26578623, 26608910, 26617911, 26681737, 26719303, 26759006, 26822383, 26851185, 26862849, 26964534, 26993499, 27094152, 27121473, 27163739, 27191652, 27323163, 27324616, 27393506, 27401140, 27463005, 27491898, 27669423, 27727484, 27766406, 2783889, 2784355, 27887569, 27894751, 28061450, 28187172, 28210081, 28239749, 28377481, 28378637, 28388539, 28475007, 2851398, 28640942, 28642246, 28817603, 28880903, 28949934, 29066174, 29105795, 29122757, 29243049, 29269008, 29350470, 29351920, 29360643, 29400599, 29466768, 29478100, 29559470, 29757775, 29767245, 29805109, 30006485, 30042403, 30046006, 30069490, 30075702, 30075815, 30093453, 30123214, 30144808, 30219078, 30221739, 30259082, 30267840, 30282837, 30285662, 30382883, 30389786, 30483834, 30505306, 30562358, 30619360, 30659053, 30683863, 30718678, 30719701, 30925186, 30963401, 30977974, 30978241, 31006654, 31066485, 31145753, 31205958, 31229590, 31275310, 31340866, 31354723, 31481117, 31495665, 31549213, 31562978, 31567189, 31609157, 31624246, 31631566, 31660687, 31690954, 31729458, 31740786, 31874858, 31879171, 31921188, 32074080, 32082077, 32111794, 32124416, 32222891, 32246006, 32277125, 32433601, 32497499, 32505533, 32514618, 32571262, 32589698, 32591861, 32592066, 32681091, 32728225, 32738272, 32878426, 32937437, 33007050, 33087896, 33101776, 33125511, 33205061, 33262074, 33275172, 33301062, 33310773, 33332284, 33338852, 33408343, 33462898, 33497464, 33513276, 33536348, 33546043, 33570632, 33602930, 33619294, 33676448, 33711637, 33763071, 33784259, 33785258, 33796412, 33893830, 33914317, 33968044, 33981015, 34048945, 34074699, 34086741, 34089373, 34177901, 34191790, 34218652, 34220837, 34252356, 34266885, 34362334, 34365471, 34386013, 34397869, 34484468, 34510503, 34511484, 34534729, 34539667, 34598322, 34608214, 34626165, 34635074, 34654352, 34668039, 34707600, 34711663, 34717544, 34729929, 34769191, 34796980, 34808386, 34814296, 35039463, 35042311, 35051220, 35092558, 35111387, 35149709, 35187162, 35219893, 35243806, 35321516, 35358652, 35363173, 35371002, 35379963, 35383113, 35443723, 35456394, 35481289, 35484226, 35534879, 35535782, 35603183, 35630004, 35687817, 35794182, 35831288, 35855531, 35858620, 35868661, 35881197, 35907841, 35918384, 35940161, 35969754, 35973335, 35975176, 36040405, 36064338, 36070764, 36208136, 36219677, 36221095, 36224603, 36232369, 36275893, 36285482, 36302799, 36316038, 36319566, 36373309, 36434686, 36469096, 36505399, 36512410, 36518753, 36524209, 36536232, 36581331, 36593398, 36752300, 36814840, 36849756, 36864443, 36869048, 36871023, 36939254, 36969745, 36980192, 37000627, 37006050, 37033978, 37063862, 37090736, 37133586, 37150900, 37164914, 37170241, 37172580, 37199043, 37232845, 37313656, 37322820, 37338527, 37342362, 37349318, 37365518, 37373171, 37392167, 37453246, 37483596, 37491740, 37505479, 37523561, 37565053, 37582713, 37622107, 37648263, 37657842, 37711623, 37778272, 37899130, 37919068, 37920460, 37923822, 37928530, 37952080, 37970473, 38035072, 38057799, 38062068, 38073318, 38169538, 38244726, 38259671, 38415552, 38583239, 38594917, 39175022, 39201771, 39238637, 39264227, 39289669, 39327585, 39409156, 39508845, 39568014, 39684891, 39914494, 39955556, 39958339, 40069612, 40157887, 40183319, 40191190, 40205583, 40239399, 40243892, 40547009, 40655141, 7790320, 7909607, 7913843, 7961115, 8205556, 8331293, 8932341, 9378492, 9505825, 9566785, 9596676, 9596682, 9710220, 9731051
Neoplasms	Stimulate	17122624, 17372588, 21638125, 23826668, 28488547, 31351430, 33095470, 36588538, 7909242
Neoplasms	Inhibit	18163472, 24870595, 26927070, 27163739, 30670769, 32296437, 32761426, 34663810, 35705026, 37466381, 38077321, 40345896
Neoplasms Adipose Tissue	Associate	21801351, 33854130
Neoplasms Adipose Tissue	Stimulate	25388403
Neoplasms Cystic Mucinous and Serous	Associate	19641607
Neoplasms Glandular and Epithelial	Associate	10414503
Neoplasms Plasma Cell	Associate	23171203
Neoplasms Squamous Cell	Associate	12716470, 20110382, 23940084, 25779340, 31429521, 34529129
Neoplasms Unknown Primary	Associate	35074904
Nephritis	Associate	16879242, 24774748, 33882880
Nephritis Interstitial	Associate	36384506
Nephrosis congenital	Associate	21762125, 26123900, 28963877
Nephrosis Lipoid	Associate	1803038
Nerve Degeneration	Associate	32744608
Nervous System Diseases	Associate	26329520
Netherton Syndrome	Associate	30477583
Neuhauser syndrome	Associate	28049640
Neuralgia Postherpetic	Associate	35720399
Neurobehavioral Manifestations	Inhibit	27244229
Neuroblastoma	Associate	31141166, 32514618, 33252831, 33338852, 33968044, 34569303, 36923280, 8794385
Neurocognitive Disorders	Associate	28874213, 31107306
Neurodegenerative Diseases	Associate	25197660
Neuroectodermal Tumors Primitive	Associate	26963506
Neurofibrosarcoma	Associate	28475007
Neuroinflammatory Diseases	Associate	24282598
Neuromyelitis Optica	Associate	23202893
Neurosyphilis	Associate	29167762, 38174681
Neurotoxicity Syndromes	Inhibit	36097223
Neutropenia	Associate	10583274, 19344427, 31866622
Neutropenia and hyperlymphocytosis with large granular lymphocytes	Associate	11737000
Neutrophilia Hereditary	Inhibit	33613548
Nijmegen Breakage Syndrome	Associate	11427422
Nijmegen Breakage Syndrome	Inhibit	14632755
Non alcoholic Fatty Liver Disease	Associate	34552988, 34850389, 36865544, 37089050, 37373554
Non Muscle Invasive Bladder Neoplasms	Associate	35958598
Noncommunicable Diseases	Associate	34970271
Noninsulin dependent diabetes mellitus with deafness	Associate	38499449
Nose Diseases	Associate	19639723
Obesity	Stimulate	22044858, 22228716
Obesity	Associate	29956501, 33123595, 34231954, 34576307, 34721414, 34850389, 35111163, 36194662, 36945068, 37063877, 37878496, 38207130, 39765379, 39868576
Obesity Maternal	Stimulate	33912153
Obesity Morbid	Associate	37266430
Oculocerebrorenal Syndrome	Stimulate	25350973
Oncogene Addiction	Associate	21486722
Opportunistic Infections	Associate	11982603, 22398371, 26683952, 28299915, 31191551, 36840494, 8609222
Opportunistic Infections	Inhibit	37133586
Optic Nerve Diseases	Associate	40160813
Organizing Pneumonia	Associate	31653682
Oropharyngeal Neoplasms	Associate	21958417
Osteoarthritis	Associate	10419780, 15731292, 20430731, 24742142, 27044824, 28112376, 29283192, 33482899, 34397812, 38401067, 39738612
Osteoarthritis	Stimulate	31205958
Osteoarthritis Hip	Associate	37731506
Osteoarthritis Knee	Associate	29283192
Osteogenesis imperfecta type 1A	Associate	35711453
Osteogenesis imperfecta type 3	Associate	34426754
Osteolysis	Associate	19214244
Osteomyelitis	Associate	32954739
Osteosarcoma	Associate	24519063, 28671022, 37150900, 40374042
Osteosarcoma	Inhibit	37993664
Otitis Media with Effusion	Stimulate	22382400
Ovarian Neoplasms	Associate	19673890, 21829534, 22083345, 23354626, 23526963, 24244610, 24764581, 31064389, 31537619, 33381581, 33414414, 35940161, 36545327, 36604635, 36837407, 37063862, 37317670, 37446361, 37950246, 7648722, 8407555
Pagetoid Reticulosis	Associate	18342715
Pain	Associate	35720399
Pancreatic Neoplasms	Associate	16947023, 19798410, 25827621, 31068935, 31796877, 34531868, 35012444, 36029726, 36509285, 37861515, 37881431
Pancreatic Neoplasms	Inhibit	37455016
Pancreatitis	Associate	28705256, 30894427
Pancreatitis Chronic	Associate	24797069, 34702715
Papilloma	Associate	19861144, 22322668, 28060843, 38193541
Papillomavirus Infections	Associate	23406965, 39690095, 7908483
Papillomavirus Infections	Inhibit	33007050
Paralysis	Associate	33178221
Paraneoplastic Syndromes Nervous System	Associate	32744608
Paraparesis Tropical Spastic	Associate	15864345, 15864353, 17409595, 17483473, 18190256, 18326816, 18664281, 19740339, 21208912, 22335964, 22647666, 23405908, 23409198, 24041428, 24845974, 24960164, 26358743, 31340370, 33837058, 39339919, 40004169
Paraparesis Tropical Spastic	Stimulate	8052162
Paraproteinemias	Associate	8605346
Paresthesia	Associate	19740340
Parkinson Disease	Associate	19505389, 20813038, 23054369, 27230441, 32884248, 33272323, 33386815, 33514545, 34289265, 35279225, 36224715, 36499121, 36591658, 37454237, 39769168
Parkinson Disease	Inhibit	24933638
Paroxysmal nonkinesigenic dyskinesia	Associate	21912648
Pathological Conditions Anatomical	Associate	29992127
Peanut Hypersensitivity	Associate	29408715, 30304054, 31654649, 33658990
pediatric multisystem inflammatory disease COVID 19 related	Associate	34035116
Pediatric Obesity	Associate	30809229
Pelvic Organ Prolapse	Associate	37266648
Pemphigoid Bullous	Associate	15320912, 29335495
Pemphigoid Bullous	Inhibit	22310732
Pemphigus	Associate	18373702, 24813052, 33741391, 36203615
Pemphigus and fogo selvagem	Associate	10642599, 35632621
Peri Implantitis	Associate	36267464
Periapical Diseases	Associate	39972438
Periodic fever familial autosomal dominant	Associate	17767733, 33176801
Periodontal Diseases	Associate	12067311, 22066676, 7685315
Periodontitis	Associate	10632663, 26732676, 27334899, 30944162, 37063877, 8608641
Periodontitis	Stimulate	33109155
Peripheral Arterial Disease	Associate	40761788
Peripheral Nervous System Diseases	Associate	36671424
Periprosthetic Fractures	Associate	19214244
Peritoneal Neoplasms	Associate	33269456
Peritonitis	Associate	12942579
Peritonitis	Inhibit	16703796, 34360900
Persistent Infection	Associate	1678437, 19146663, 24298980
Pheochromocytoma	Associate	34531868
Pituitary ACTH Hypersecretion	Associate	30722035
Plaque Atherosclerotic	Associate	15879154, 18832677, 19843577, 22282196, 34636650, 36077273
Plasma Cell Granuloma Pulmonary	Associate	24995984
Plasmablastic Lymphoma	Associate	15578069, 35523507
Pleural Effusion	Associate	1371640, 18925324, 19414323, 24069325, 24134738, 27586092, 7890378, 8100745
Pleural Effusion Malignant	Associate	14612896, 18064389, 29785404, 30816121, 39325190
Pneumonia	Associate	12952926, 30644704, 31310589, 36171010, 37459093, 37497667
Pneumonia	Inhibit	31842954, 35095920, 40190436
Pneumonia Pneumocystis	Associate	32911508, 9769325
Poliomyelitis	Associate	26271191
Polychondritis Relapsing	Associate	15147365
Polycystic Ovary Syndrome	Associate	30988342, 34847942, 37226082, 38189053, 39754246
Polycythemia Vera	Associate	35025147
Polymyalgia Rheumatica	Associate	14672892
Polymyositis	Associate	17195241, 19953283, 30157932
Polyps	Associate	17063750, 26684290, 33817728
Post Acute COVID 19 Syndrome	Associate	33993490, 34611034, 35746736, 37753077, 39284068, 39615603
Post Infectious Disorders	Associate	37471146
Pouchitis	Stimulate	9824577
Pre Eclampsia	Stimulate	12623476, 36708687
Pre Eclampsia	Associate	22837649, 28502089
Pre Eclampsia	Inhibit	26515425, 37921073
Precancerous Conditions	Associate	35947128, 38366919
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	21923643, 8652829
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	16459188, 1672098, 2195543, 2365056, 23975177, 26474588, 2822168, 3259951, 40076625
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	16371020, 28801656, 3058229, 7519476
Prediabetic State	Associate	34737186
Premature Birth	Stimulate	21347427
Premature Birth	Associate	36027951
Prieto X linked mental retardation syndrome	Associate	12699424
Primary Immunodeficiency Diseases	Associate	31572362, 33193371, 37161048
Primary Myelofibrosis	Inhibit	21282192
Primary Myelofibrosis	Associate	32732359, 34238135
Prodromal Symptoms	Associate	19779716
Prostatic Hyperplasia	Associate	22157983, 34606081
Prostatic Intraepithelial Neoplasia	Associate	29105795
Prostatic Neoplasms	Associate	12077288, 18519750, 22647697, 25119597, 28681697, 29105795, 31355524, 32923127, 33785258, 33837451, 33985534, 34806485, 35764368, 36499557, 36686485, 36759726, 37857190, 38062230, 40121536, 9627224
Prostatic Neoplasms Castration Resistant	Associate	23319273
Prostatitis	Associate	30378157
Prosthesis Failure	Associate	19214244, 28213791
Proteinuria	Associate	24774748
Pruritus	Associate	35523507
Psoriasis	Associate	20943046, 22291603, 23750651, 24286492, 25568543, 29280140, 30747724, 34108969, 7653183
Psychological Distress	Associate	26173605
Psychological Distress	Stimulate	37815881
Pulmonary Arterial Hypertension	Associate	34233597, 35960497, 36248192, 36555549, 37753829, 39769220
Pulmonary Disease Chronic Obstructive	Associate	16246539, 18684844, 19220836, 19378224, 19604272, 19729666, 21651772, 22183488, 23374856, 24805101, 25315895, 25375131, 27549738, 27613775, 27793198, 28053515, 29179729, 30842769, 30988604, 31141166, 31440043, 33223825, 33317530, 33435988, 34426754, 35096207, 35740993, 35991707, 36127695, 37286295, 39346628, 40234829
Pulmonary Disease Chronic Obstructive	Stimulate	17050556, 28934595
Pulmonary Disease Chronic Obstructive	Inhibit	25137293, 29206476, 33651771, 34435653
Pulmonary Edema	Inhibit	25010330
Pulmonary Embolism	Associate	35572511
Pulmonary Emphysema	Associate	18062794
Pulmonary Fibrosis	Associate	18250483, 25536276, 37731513, 7905208
Purpura	Associate	25736842
Purpura Thrombocytopenic Idiopathic	Associate	10583274, 16212887, 18519809, 19056692, 23215839, 24338252, 24433164, 25561904, 25978334, 26287565, 28054583, 28419421, 29333980, 30403287, 30944836, 31273052, 31651870, 31866622, 32419211, 32574429, 34144109, 34329516, 34445858, 37291547, 37660478, 38184203
Purpura Thrombocytopenic Idiopathic	Inhibit	1840468, 22875869
Purpura Thrombotic Thrombocytopenic	Associate	26747250
Purpura Thrombotic Thrombocytopenic	Inhibit	35507753
Pyruvate Carboxylase Deficiency Disease	Associate	1929608
Q Fever	Associate	22098165, 25211350, 9008288
Radiation Injuries	Associate	23559597
Radicular Cyst	Associate	39972438
Rectal Neoplasms	Associate	27053849, 34531868, 35534879
Recurrent respiratory papillomatosis	Associate	22322668, 28805308
Red Cell Aplasia Pure	Associate	10583274, 16044445
Renal Insufficiency	Inhibit	12719595, 19417582
Renal Insufficiency	Associate	16796525, 1827129, 18454861, 19417582, 19918105, 19949656, 21917895, 22739389, 23280237, 23289841, 24583671, 25166019, 25428920, 26584666, 26627102, 27191978, 27355415, 28086929, 28387865, 28604824, 29672676, 30063722, 33151020
Renal Insufficiency	Stimulate	25935494
Renal Insufficiency Chronic	Associate	21873805, 21993694, 24347824, 29619880
Reperfusion Injury	Associate	19283744, 37105441
Reproductive Tract Infections	Associate	23555586
Respiratory Distress Syndrome	Associate	34898369, 36809070, 40190436
Respiratory Insufficiency	Inhibit	32320677
Respiratory Sounds	Associate	18614563, 31901157
Respiratory Syncytial Virus Infections	Associate	26162090
Respiratory Tract Diseases	Associate	40234829
Respiratory Tract Infections	Associate	17362263
Restless Legs Syndrome	Associate	36499121
Retinal Dysplasia	Associate	31343468, 34919260
Retinoschisis	Associate	33601057
Retroperitoneal Neoplasms	Associate	33974080
Retroviridae Infections	Associate	32907866
Rheumatic Diseases	Associate	26076982, 32878464
Rheumatic Heart Disease	Associate	28143491
Rhinitis	Associate	30537802
Rhinitis Allergic	Associate	17156343, 17349011, 18797179, 21919915, 24514067, 30537802, 33224143, 36149748, 36713372
Rhinitis Allergic Seasonal	Stimulate	12653839
Rhinitis Allergic Seasonal	Associate	21975176, 22670772, 22701743, 24062574, 24391521, 24834772, 35942560
Ring Chromosome 20 Syndrome	Inhibit	39367456
Robinow Syndrome	Associate	9321759
Rufous oculocutaneous albinism	Associate	34668039
Rufous oculocutaneous albinism	Inhibit	34668039
Rupture	Associate	19394279, 19843577
Salivary Gland Diseases	Associate	34925329, 9038756
Sarcoidosis	Associate	10092696, 10908151, 11091281, 11923555, 14508706, 17975675, 18279440, 19480659, 19536643, 21177920, 21959269, 22469005, 22537923, 23630356, 23863960, 24681356, 25004830, 25073001, 26415669, 2669224, 27230441, 27575817, 28827283, 30585624, 32063460, 32508528, 33363531, 35761164, 36613701, 37520566, 37863732, 38097354, 7586698, 7910965, 8529107, 8881751, 9311498
Sarcoidosis	Inhibit	24882950, 8143813
Sarcoidosis	Stimulate	30452447, 8137547, 9176534
Sarcoidosis Pulmonary	Associate	11359967, 23630356, 26585430, 29055517, 29234685, 34753769
Sarcoma	Inhibit	36005179
Sarcoma	Associate	37192046
Sarcoma Ewing	Inhibit	34440851
Sarcoma Kaposi	Associate	11165927, 22045987, 22787430, 29746555, 33799006, 7521102
Sarcosinemia	Associate	28387599
Schizophrenia	Associate	27244229, 37552420
Schizophrenia	Stimulate	38066312
Scleroderma Systemic	Associate	15730402, 19536281, 20973920, 2138008, 21996293, 27145754, 29248544, 31767698, 32977850, 33307312, 35183246, 35663995, 8484693
Scleroderma Systemic	Stimulate	31848026
Seizures	Associate	23639073, 38057734
Sepsis	Associate	27459386, 30327490, 30470767, 31484735, 35720398
Sepsis	Stimulate	34898369, 36250055
Sepsis	Inhibit	40190436
Severe Acute Respiratory Syndrome	Inhibit	12955652, 32217835
Severe Acute Respiratory Syndrome	Associate	16937439, 17872527, 21813600, 28426727, 33902571, 35673765
Severe Combined Immunodeficiency	Associate	11110711, 1320968, 27301863, 7905018, 8287598, 8920891, 9446656, 9664084
Severe combined immunodeficiency due to adenosine deaminase deficiency	Associate	18218852, 9420304
Severe Dengue	Associate	17626101
Severe Fever with Thrombocytopenia Syndrome	Associate	37903435
Sexually Transmitted Diseases	Associate	22190722, 31619762
Sezary Syndrome	Associate	11168816, 11348462, 11442758, 12200382, 12437636, 1381718, 15009733, 15245439, 15315967, 1562047, 16418328, 17713571, 18314443, 19211505, 1987293, 19935642, 20663947, 20713771, 20801618, 21085192, 21191411, 23792457, 25806852, 26930587, 27732942, 27766406, 27889686, 28441377, 32760603, 35533722, 7777538, 9717967
Shock	Associate	37614152
Shock Septic	Associate	33613540
Sialadenitis	Associate	27358392
Sick Sinus Syndrome	Associate	10403921
Sickle Cell Trait	Associate	34496009
Signs and Symptoms Digestive	Associate	31457091
Silicosis	Associate	16831302, 21244759, 36587204
Simian Acquired Immunodeficiency Syndrome	Associate	23185351
Sjogren's Syndrome	Associate	10446867, 1720300, 18684981, 23738744, 24117612, 24574234, 26436101, 27346388, 27461134, 28494936, 28621822, 28743286, 29453859, 30336792, 30589451, 30632148, 33050949, 33179091, 33603736, 33883324, 33936039, 34095321, 35944186, 36171070, 37569326, 39480501, 40257948, 40650157, 7683586
Sjogren's Syndrome	Stimulate	32963045, 34641948, 36505431
Sjogren's Syndrome	Inhibit	7578884, 8082485
Skin Diseases	Associate	10504451, 10886244, 11511293, 12750155, 1673877, 16782037, 22992805, 23566249, 24286492, 24335103, 34220814
Skin Neoplasms	Associate	12576313
Sleep Apnea Obstructive	Stimulate	19581829
Small Cell Lung Carcinoma	Associate	18004564, 32020764, 33674986, 34006632, 35834843
Smoke Inhalation Injury	Inhibit	40345896
Soft Tissue Injuries	Associate	33893236
Spastic Paraplegia Hereditary	Associate	19740340
Spinal Cord Diseases	Associate	15864353, 17483473, 18664281, 20945034, 24960164
Spinal Cord Injuries	Associate	38139422
Splenic Neoplasms	Associate	23037630
Splenic Neoplasms	Inhibit	35610016
Spondylitis Ankylosing	Associate	11207664, 12932293, 15498047, 16180249, 16277694, 20722024, 21248258, 26841353, 27901054, 29960293, 34108969
Spondylitis Ankylosing	Inhibit	25142923
Squamous Cell Carcinoma of Head and Neck	Associate	12716470, 17235436, 18221909, 18547033, 18559587, 19825957, 20857101, 21442435, 22252752, 22252753, 23826668, 23977174, 24761979, 25153698, 26313665, 26740106, 28574843, 28947422, 29416107, 31662531, 31924475, 32441311, 32719094, 33010009, 33053760, 33125511, 33173143, 33307825, 33390791, 33457076, 33462898, 33513276, 33529452, 33995377, 34373557, 34531868, 34626165, 35039463, 36319566, 36425786, 36512410, 36627705, 36864443, 36930079, 37270478, 37459093, 37828063, 37898859, 38077321, 38129784, 7961115
Squamous Cell Carcinoma of Head and Neck	Stimulate	32383556
Squamous Intraepithelial Lesions	Associate	33605553
Squamous Intraepithelial Lesions	Stimulate	34919260
ST Elevation Myocardial Infarction	Associate	26375412, 35354890
Status Asthmaticus	Associate	11429397, 12952249, 15944327, 16883065, 19473523, 20059479, 20926789, 20943044, 21917308, 23110234, 23893806, 24934276, 27708065, 30644695, 31685437, 32914944, 33271553, 38129444, 7596088, 9108409
Stevens Johnson Syndrome	Associate	11004109, 37074725
Stiff Skin Syndrome	Stimulate	25314253
Still's Disease Adult Onset	Inhibit	30052100
Still's Disease Adult Onset	Associate	34319596
Stomach Diseases	Associate	27306341
Stomach Neoplasms	Associate	12942579, 14568977, 20819431, 21528082, 23365642, 2522349, 25260881, 26464703, 27323782, 28488547, 30988066, 31631566, 32028262, 32129682, 32987562, 33312758, 33426088, 33492335, 33837660, 33843442, 34746312, 34868341, 34968167, 35382776, 36249422, 36737759, 37342362, 37359529, 37366273, 37467193, 37499395, 37781029, 38042786, 38090588, 38259671, 38368775, 39299554, 39328412, 39781526
Stomach Neoplasms	Stimulate	15618192, 37153541
Stomach Neoplasms	Inhibit	37904396
Stomatitis Aphthous	Associate	21478439
Stroke	Associate	24650222, 29697202, 33205448
Subcutaneous panniculitis like T cell lymphoma	Associate	17934071
Syndrome	Associate	33179091, 33332284
Syndrome	Inhibit	34916230
Synovial Cyst	Associate	16838043
Synovitis	Associate	17907166, 9260157
Syphilis	Associate	32873094
T cell immunodeficiency primary	Associate	1380169, 9626046
T Lymphocytopenia	Associate	18166773, 19039197
T Lymphocytopenia Idiopathic CD4 Positive	Associate	18456875, 19039197, 23383227, 25733583, 37133586, 8609222
T Lymphocytopenia Idiopathic CD4 Positive	Inhibit	22454463, 31781092
Tachycardia Atrioventricular Nodal Reentry	Stimulate	23826668
Takayasu Arteritis	Associate	15544635, 31888748, 33538119, 9030862
Tang Hsi Ryu syndrome	Associate	30336792, 33196557, 38022535
Tangier Disease	Associate	30092832
Telangiectasia Hereditary Hemorrhagic	Associate	23772771
Tertiary Lymphoid Structures	Associate	26763360, 29749506, 30670769, 32963045
Tertiary Lymphoid Structures	Stimulate	33796412
Testicular Germ Cell Tumor	Associate	34531868
Testicular Neoplasms	Associate	16030183, 28555838, 32744608
Tetany	Stimulate	19903780, 21690475
Tetany	Associate	25617427, 26271191
Thrombocytopenia	Associate	35586668
Thrombosis	Associate	40190436
Thrombotic thrombocytopenic purpura acquired	Associate	26747250
Thymoma	Associate	10403908, 10886240, 12820694, 14575152, 19886737, 34531868, 9867130
Thymus Neoplasms	Associate	12116341, 2783859, 38071307, 9345067
Thyroid cancer medullary	Associate	36319978
Thyroid Cancer Papillary	Associate	34465342, 34790166
Thyroid Neoplasms	Associate	1375873, 27045886, 34539667
Thyroiditis	Associate	32323619
Thyroiditis Autoimmune	Associate	14971052, 15147360, 16698664, 19040601, 27855396, 32045626, 34144109, 37501789, 40155866
Thyroiditis Autoimmune	Stimulate	18637101
Thyroiditis Autoimmune	Inhibit	23249428, 27206624
Thyroiditis Chronic	Inhibit	21147625
Thyroiditis Subacute	Associate	37451415
Tic Disorders	Inhibit	34257142
Tn Syndrome	Associate	32961930
Tongue Diseases	Stimulate	11986779
Tonsillitis	Associate	28877231, 30728285, 34045665
Tooth Erosion	Associate	27306341
Tourette Syndrome	Associate	26709833
Toxoplasmosis	Inhibit	36840494
Toxoplasmosis Cerebral	Associate	32364106
Toxoplasmosis Ocular	Associate	23100559, 39277179
Tracheal Stenosis	Associate	37647429
Translocation Genetic	Associate	25225461
Trauma Nervous System	Associate	39352388
Trichothiodystrophy Syndromes	Associate	12121441
Triple Negative Breast Neoplasms	Associate	27727484, 30221739, 30305342, 32529292, 32971948, 33301062, 34789319, 35705026, 35797509, 36412444, 37090736, 37199043, 37810779, 38308298, 39643914
Triple Negative Breast Neoplasms	Stimulate	38170155
Tuberculosis	Associate	11972637, 11982602, 12780692, 14678204, 15373915, 15459144, 16542361, 19438599, 21186260, 22087280, 22215422, 22431997, 22719887, 23293360, 24694750, 25520147, 25822019, 25974183, 26611774, 26927799, 27553411, 27861807, 27924827, 30218032, 30231065, 30233588, 30728405, 31678658, 31681314, 31952232, 33720848, 33945513, 34162973, 36619740, 37809012, 38642678, 8565282, 9353145
Tuberculosis	Inhibit	16767318
Tuberculosis	Stimulate	29489879, 29635002
Tuberculosis Central Nervous System	Associate	22111973
Tuberculosis Extrapulmonary	Associate	22215422, 33391271
Tuberculosis Lymph Node	Associate	1440463
Tuberculosis Meningeal	Associate	15708307, 22961735, 23826366, 23840403, 27383726, 27861807, 34176483, 35552657, 36040958
Tuberculosis Multidrug Resistant	Inhibit	20655262
Tuberculosis Multidrug Resistant	Associate	27681197, 33977111
Tuberculosis Pleural	Associate	21625607, 21887301, 24069325, 24134738, 37809012
Tuberculosis Pleural	Stimulate	21829471
Tuberculosis Pulmonary	Associate	11722641, 11748166, 1440463, 15459144, 28881482, 29472922, 29489879, 30231065, 35293343, 39337460
Tumor Virus Infections	Associate	33310773
Turcot syndrome	Stimulate	26496037
Turner Syndrome	Associate	26709833
Ureteral Neoplasms	Associate	29243545
Urethral Neoplasms	Associate	34220837, 36939254
Urinary Bladder Neoplasms	Associate	19692168, 26862849, 26927070, 29478100, 30075815, 32228629, 32497499, 34531868, 35669725, 35958598, 36162993, 37313656, 37632832
Urogenital Neoplasms	Associate	33262136
Uterine Cervical Dysplasia	Associate	12121440, 33007050
Uterine Cervical Neoplasms	Associate	10364287, 10864677, 17615234, 19386711, 22094905, 26486970, 31562978, 32306508, 32518078, 33605553, 37344577, 38084896, 9621091
Uterine Cervical Neoplasms	Stimulate	17937675, 23587428
Uterine Cervical Neoplasms	Inhibit	33694292
Uterine Cervicitis	Associate	29454382, 33007050
Uterine Diseases	Associate	36552753
Uveal melanoma	Associate	19557412, 26712692, 32496920, 34531868
Uveitis	Associate	14977779, 15196263, 23527071, 32479651
Uveitis	Stimulate	23818738
Uveitis Anterior	Associate	15043537
Uveitis Intermediate	Stimulate	10361227
Uveitis Posterior	Associate	7882564
Uveomeningoencephalitic Syndrome	Associate	21297967, 28761327
Vaginosis Bacterial	Associate	30407498
Varicocele	Stimulate	32635770
Vascular Diseases	Associate	15171817, 26603521, 28972094, 33196557, 35883458, 8669478
Vascular System Injuries	Associate	17919564, 20430391, 25484131
Vasculitis	Associate	19381293, 21484763, 28916770, 30510966, 34950150, 37952293, 9808568
Venous Insufficiency	Associate	35883458
Venous Thromboembolism	Associate	25001165
Viremia	Associate	11717444, 15117455, 16246391, 16272355, 16809324, 19535437, 19690337, 19911963, 22287716, 24148296, 26068923, 26842474, 31118290, 31677350, 36450262, 36602866
Virus Diseases	Associate	10220446, 11533159, 15284108, 20147895, 23185351, 23569328, 24194773, 24391825, 26776123, 30459072, 30692574, 31440240, 32668411, 33228556, 33965183, 34095321, 35660868, 36450262, 36596303, 36841352, 37669378, 38129444
Vitamin D Deficiency	Associate	34764490
Vitiligo	Associate	18548110, 34107850, 37731844, 7871844
Vitiligo	Inhibit	33200798
Vulvar Lichen Sclerosus	Associate	33438816
Warts	Associate	31781092, 34916230
Wells syndrome	Associate	17362263
West Nile Fever	Associate	32038660
White Coat Hypertension	Associate	18689680, 31581595
Whooping Cough	Associate	22550536, 24176499, 25787136
Wilms Tumor	Associate	30981637, 34597382
Winter Shortland Temple syndrome	Associate	29367348
Wiskott Aldrich Syndrome	Associate	1512549, 17082665, 27396937, 8918565
Wolf Hirschhorn Syndrome	Associate	37073435
Wounds and Injuries	Stimulate	28671900
Wounds and Injuries	Associate	33966343, 9804349
ZAP70 deficiency	Associate	33471124
Zika Virus Infection	Associate	32132999