CD4 (CD4 molecule)

Gene

• Entrez ID: 920
• Gene name: CD4 molecule
• Gene symbol: CD4
• Synonyms (NCBI Gene): CD4mut, IMD79, Leu-3, OKT4D, T4
• Chromosome: 12
• Chromosome location: 12p13.31
• Summary: This gene encodes the CD4 membrane glycoprotein of T lymphocytes. The CD4 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class II MHC molecules. The

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs28919570	C>T	Conflicting-interpretations-of-pathogenicity	Missense variant, 5 prime UTR variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT053201	hsa-miR-181a-5p	Flow, qRT-PCR, Western blot	23393335
MIRT720059	hsa-miR-4713-3p	HITS-CLIP	19536157
MIRT720058	hsa-miR-638	HITS-CLIP	19536157
MIRT720057	hsa-miR-450b-3p	HITS-CLIP	19536157
MIRT720056	hsa-miR-769-3p	HITS-CLIP	19536157
MIRT479660	hsa-miR-1273d	PAR-CLIP	23592263
MIRT479659	hsa-miR-5197-5p	PAR-CLIP	23592263
MIRT479658	hsa-miR-3125	PAR-CLIP	23592263
MIRT479657	hsa-miR-3916	PAR-CLIP	23592263
MIRT479656	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT479655	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT479654	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT479653	hsa-miR-665	PAR-CLIP	23592263
MIRT479652	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT479651	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT479650	hsa-miR-4786-3p	PAR-CLIP	23592263
MIRT479649	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT479648	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT479647	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT479646	hsa-miR-4470	PAR-CLIP	23592263
MIRT479645	hsa-miR-4505	PAR-CLIP	23592263
MIRT479644	hsa-miR-5787	PAR-CLIP	23592263
MIRT479643	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT479642	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT479641	hsa-miR-877-5p	PAR-CLIP	23592263
MIRT479640	hsa-miR-7843-3p	PAR-CLIP	23592263
MIRT479639	hsa-miR-3674	PAR-CLIP	23592263
MIRT733042	hsa-miR-375	ELISA, qRT-PCR, Western blotting	33938607
MIRT736025	hsa-miR-125b-5p	Microarray, qRT-PCR	33179091
MIRT736029	hsa-miR-155-5p	Microarray, qRT-PCR	33179091
MIRT720059	hsa-miR-4713-3p	HITS-CLIP	19536157
MIRT720058	hsa-miR-638	HITS-CLIP	19536157
MIRT720057	hsa-miR-450b-3p	HITS-CLIP	19536157
MIRT720056	hsa-miR-769-3p	HITS-CLIP	19536157
MIRT479660	hsa-miR-1273d	PAR-CLIP	23592263
MIRT479659	hsa-miR-5197-5p	PAR-CLIP	23592263
MIRT479658	hsa-miR-3125	PAR-CLIP	23592263
MIRT479657	hsa-miR-3916	PAR-CLIP	23592263
MIRT479656	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT479655	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT479654	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT479653	hsa-miR-665	PAR-CLIP	23592263
MIRT479652	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT479651	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT479650	hsa-miR-4786-3p	PAR-CLIP	23592263
MIRT479649	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT479648	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT479647	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT479646	hsa-miR-4470	PAR-CLIP	23592263
MIRT479645	hsa-miR-4505	PAR-CLIP	23592263
MIRT479644	hsa-miR-5787	PAR-CLIP	23592263
MIRT479643	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT479642	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT479641	hsa-miR-877-5p	PAR-CLIP	23592263
MIRT479640	hsa-miR-7843-3p	PAR-CLIP	23592263
MIRT479639	hsa-miR-3674	PAR-CLIP	23592263
MIRT875411	hsa-miR-1254	CLIP-seq
MIRT875412	hsa-miR-1321	CLIP-seq
MIRT875413	hsa-miR-3116	CLIP-seq
MIRT875414	hsa-miR-3151	CLIP-seq
MIRT875415	hsa-miR-3176	CLIP-seq
MIRT875416	hsa-miR-3919	CLIP-seq
MIRT875417	hsa-miR-3922-3p	CLIP-seq
MIRT875418	hsa-miR-4447	CLIP-seq
MIRT875419	hsa-miR-4455	CLIP-seq
MIRT875420	hsa-miR-4472	CLIP-seq
MIRT875421	hsa-miR-4475	CLIP-seq
MIRT875422	hsa-miR-4654	CLIP-seq
MIRT875423	hsa-miR-4712-3p	CLIP-seq
MIRT875424	hsa-miR-4728-5p	CLIP-seq
MIRT875425	hsa-miR-4739	CLIP-seq
MIRT875426	hsa-miR-4756-3p	CLIP-seq
MIRT875427	hsa-miR-4756-5p	CLIP-seq
MIRT875428	hsa-miR-4757-5p	CLIP-seq
MIRT875429	hsa-miR-4769-5p	CLIP-seq
MIRT875430	hsa-miR-4779	CLIP-seq
MIRT875431	hsa-miR-491-5p	CLIP-seq
MIRT875432	hsa-miR-539	CLIP-seq
MIRT875433	hsa-miR-555	CLIP-seq
MIRT875434	hsa-miR-661	CLIP-seq
MIRT875435	hsa-miR-765	CLIP-seq
MIRT875436	hsa-miR-1256	CLIP-seq
MIRT875437	hsa-miR-2355-3p	CLIP-seq
MIRT875438	hsa-miR-3140-5p	CLIP-seq
MIRT875439	hsa-miR-3688-5p	CLIP-seq
MIRT875421	hsa-miR-4475	CLIP-seq
MIRT875440	hsa-miR-4527	CLIP-seq
MIRT875441	hsa-miR-4646-3p	CLIP-seq
MIRT875442	hsa-miR-4710	CLIP-seq
MIRT875430	hsa-miR-4779	CLIP-seq
MIRT875443	hsa-miR-4790-3p	CLIP-seq
MIRT875444	hsa-miR-4792	CLIP-seq
MIRT875445	hsa-miR-516b	CLIP-seq
MIRT875433	hsa-miR-555	CLIP-seq
MIRT875446	hsa-miR-644	CLIP-seq
MIRT875435	hsa-miR-765	CLIP-seq
MIRT1959526	hsa-miR-1302	CLIP-seq
MIRT1959527	hsa-miR-1827	CLIP-seq
MIRT1959528	hsa-miR-3150a-3p	CLIP-seq
MIRT1959529	hsa-miR-3175	CLIP-seq
MIRT1959530	hsa-miR-4298	CLIP-seq
MIRT1959531	hsa-miR-4667-5p	CLIP-seq
MIRT1959532	hsa-miR-4700-5p	CLIP-seq
MIRT1959533	hsa-miR-939	CLIP-seq
MIRT2677705	hsa-miR-1224-3p	CLIP-seq
MIRT2677706	hsa-miR-1260	CLIP-seq
MIRT2677707	hsa-miR-1260b	CLIP-seq
MIRT2677708	hsa-miR-1280	CLIP-seq
MIRT2677709	hsa-miR-4281	CLIP-seq
MIRT2677710	hsa-miR-627	CLIP-seq
MIRT2677711	hsa-miR-924	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Unknown	9765424
EIF2AK2	Unknown	8995707
HES1	Repression	11287612
MAZ	Unknown	7760814
MYB	Repression	11287612
TCF3	Unknown	17486074

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IDA	9641677
GO:0001618	Function	Virus receptor activity	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	24942581
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002684	Process	Positive regulation of immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	10358157
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005201	Function	Extracellular matrix structural constituent	NAS	12444132
GO:0005515	Function	Protein binding	IPI	7831289, 9168119, 10816381, 10922058, 11113139, 11264384, 15660419, 16888650, 17005671, 17301785, 19333378, 20080564, 20357769, 23890821, 26098315, 27114505, 30542158, 32814053
GO:0005769	Component	Early endosome	TAS
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IDA	2823150, 8124721, 11390434, 19333378, 24942581
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	NAS	8512039
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	TAS	9558100, 10358157
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9780207
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	TAS	10358157
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	NAS	8512039
GO:0008270	Function	Zinc ion binding	IDA	9668045
GO:0008289	Function	Lipid binding	EXP	9622505, 19781520
GO:0009897	Component	External side of plasma membrane	IDA	17213291
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	IEA
GO:0015026	Function	Coreceptor activity	IEA
GO:0015026	Function	Coreceptor activity	NAS	8512039
GO:0015026	Function	Coreceptor activity	TAS	8674120
GO:0016020	Component	Membrane	IEA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0019865	Function	Immunoglobulin binding	IEA
GO:0019899	Function	Enzyme binding	IPI	19333378
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	7486703
GO:0023026	Function	MHC class II protein complex binding	IDA	27114505
GO:0030217	Process	T cell differentiation	IDA	1533274
GO:0030225	Process	Macrophage differentiation	IMP	24942581
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0032355	Process	Response to estradiol	IEA
GO:0032507	Process	Maintenance of protein location in cell	IDA	15128768
GO:0032743	Process	Positive regulation of interleukin-2 production	NAS	1901411
GO:0033280	Process	Response to vitamin D	IEA
GO:0033674	Process	Positive regulation of kinase activity	IDA	24942581
GO:0035397	Process	Helper T cell enhancement of adaptive immune response	IEA
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IDA	24942581
GO:0038023	Function	Signaling receptor activity	TAS	10413516
GO:0042011	Function	Interleukin-16 binding	IPI	24942581
GO:0042012	Function	Interleukin-16 receptor activity	IDA	24942581
GO:0042101	Component	T cell receptor complex	NAS	8512039
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042110	Process	T cell activation	IEA
GO:0042289	Function	MHC class II protein binding	IDA	2823150, 11535811
GO:0042289	Function	MHC class II protein binding	IPI	24942581
GO:0042289	Function	MHC class II protein binding	NAS	8512039
GO:0042802	Function	Identical protein binding	IPI	9168119
GO:0042803	Function	Protein homodimerization activity	IDA	9168119, 12444132
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	24942581
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	24942581
GO:0045058	Process	T cell selection	IDA	9551897
GO:0045121	Component	Membrane raft	IDA	9168119
GO:0045121	Component	Membrane raft	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045657	Process	Positive regulation of monocyte differentiation	IDA	24942581
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	2118992
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	24942581
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	24942581
GO:0046718	Process	Symbiont entry into host cell	IDA	9641677
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IEA
GO:0050863	Process	Regulation of T cell activation	IDA	1533274
GO:0050863	Process	Regulation of T cell activation	IEA
GO:0050870	Process	Positive regulation of T cell activation	IEA
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0051924	Process	Regulation of calcium ion transport	IDA	24942581
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	24942581
GO:0097011	Process	Cellular response to granulocyte macrophage colony-stimulating factor stimulus	IDA	24942581
GO:1904313	Process	Response to methamphetamine hydrochloride	IEA
GO:1904637	Process	Cellular response to ionomycin	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IPI	3262426

Other IDs

• MIM: 186940
• HGNC: 1678
• e!Ensembl: ENSG00000010610

Protein

• UniProt ID: P01730
• Protein name: T-cell surface glycoprotein CD4 (T-cell surface antigen T4/Leu-3) (CD antigen CD4)
• Protein function: Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:
• PDB: 1CDH, 1CDI, 1CDJ, 1CDU, 1CDY, 1G9M, 1G9N, 1GC1, 1JL4, 1Q68, 1RZJ, 1RZK, 1WBR, 1WIO, 1WIP, 1WIQ, 2B4C, 2JKR, 2JKT, 2KLU, 2NXY, 2NXZ, 2NY0, 2NY1, 2NY2, 2NY3, 2NY4, 2NY5, 2NY6, 2QAD, 3B71, 3CD4, 3J70, 3JCB, 3JCC, 3JWD, 3JWO, 3LQA, 3O2D, 3S4S, 3S5L, 3T0E, 4H8W, 4JM2, 4P9H, 4Q6I, 4R2G, 4R4H, 4RQS, 5A7X, 5A8H
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00047	ig	24 → 123	Immunoglobulin domain	Domain
  PF05790	C2-set	125 → 203	Immunoglobulin C2-set domain	Domain
  PF09191	CD4-extracel	206 → 316	CD4, extracellular	Domain
  PF05790	C2-set	317 → 390	Immunoglobulin C2-set domain	Domain
  PF12104	Tcell_CD4_C	425 → 453	T cell CD4 receptor C terminal region	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in T-helper cells. The presence of CD4 is a hallmark of T-helper cells which are specialized in the activation and growth of cytotoxic T-cells, regulation of B cells, or activation of phagocytes. CD4 is also present in
• Sequence:

  MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIK
  ILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQL
  LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG
  TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW
  QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
  LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV
  LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV
  RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI

• Sequence length: 458

Pathways

KEGG:

Viral life cycle - HIV-1
Virion - Human immunodeficiency virus
Cytokine-cytokine receptor interaction
Cell adhesion molecules
Antigen processing and presentation
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Yersinia infection
Human T-cell leukemia virus 1 infection
Human immunodeficiency virus 1 infection
PD-L1 expression and PD-1 checkpoint pathway in cancer
Primary immunodeficiency

Reactome:

Alpha-defensins
Nef Mediated CD4 Down-regulation
Binding and entry of HIV virion
Vpu mediated degradation of CD4
Downstream TCR signaling
Phosphorylation of CD3 and TCR zeta chains
Translocation of ZAP-70 to Immunological synapse
Generation of second messenger molecules
PD-1 signaling
Other interleukin signaling
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Immunodeficiency 79	Pathogenic	rs782212142, rs200294737	RCV001353064 RCV001353065	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CD4-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Okt4 epitope deficiency	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency	Associate	18362907	★☆☆☆☆ Found in Text Mining only
Abdominal Injuries	Associate	25458969	★☆☆☆☆ Found in Text Mining only
Abortion Habitual	Associate	25935494, 39941094	★☆☆☆☆ Found in Text Mining only
Abortion Habitual	Inhibit	26345847	★☆☆☆☆ Found in Text Mining only
Achondroplasia and Swiss type agammaglobulinemia	Associate	1373352	★☆☆☆☆ Found in Text Mining only
Achondroplasia and Swiss type agammaglobulinemia	Inhibit	21488866	★☆☆☆☆ Found in Text Mining only
Acidosis	Inhibit	35708739	★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Associate	33760854	★☆☆☆☆ Found in Text Mining only
Acquired Immunodeficiency Syndrome	Associate	10102648, 10400799, 10691923, 11264355, 11581379, 11696593, 11699717, 11882044, 11967325, 12719578, 1402655, 14557639, 14722279, 14990729, 15194057, 15585654, 15795268, 16103193, 16174727, 1696717, 17038537, 17388670, 17581988, 18385244, 18510766, 18596085, 19912576, 20498045, 21396133, 23258923, 23585827, 24356113, 2572558, 26730570, 27875993, 29749506, 3091303, 3258005, 33974229, 34154423, 34320023, 35163318, 36312587, 36840494, 37161335, 7509654, 7612102, 8099857, 8586703, 8609222, 8697632, 8781430, 9028959, 9038757, 9326234, 9573232, 9573296, 9576185	★☆☆☆☆ Found in Text Mining only
Acquired Immunodeficiency Syndrome	Inhibit	16721821, 1696859, 19703245, 32591400, 33202420, 35758393, 8403502, 8450057, 9878112	★☆☆☆☆ Found in Text Mining only
Acrocephalosyndactylia	Associate	23330016, 24453425, 37499395	★☆☆☆☆ Found in Text Mining only
Acrocephalosyndactylia	Inhibit	24385687	★☆☆☆☆ Found in Text Mining only
Actinic cheilitis	Stimulate	21442435	★☆☆☆☆ Found in Text Mining only
Actinic cheilitis	Associate	25060152, 35195152	★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Associate	12816883, 17919564, 18832677, 20430391, 22282196, 22711477, 23330016, 24453425, 24558424, 25484131, 25527700, 25612606, 25740578, 25997853, 26375412, 28348007, 28407684, 29211854, 29962384, 32647892, 34151742, 34313407, 37461090	★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Inhibit	24385687, 24603196, 27999237	★☆☆☆☆ Found in Text Mining only
Acute Disease	Associate	23012327, 25663681	★☆☆☆☆ Found in Text Mining only
Acute Disease	Inhibit	29636753	★☆☆☆☆ Found in Text Mining only
Acute On Chronic Liver Failure	Associate	22978653, 26173605, 33613548, 34869773	★☆☆☆☆ Found in Text Mining only
Acute On Chronic Liver Failure	Stimulate	37317515	★☆☆☆☆ Found in Text Mining only
Addison Disease	Associate	16252254, 24667071	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Stimulate	17082613, 35187162	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Associate	19596931, 31533488, 32487090, 32562536, 34531868, 35445138, 37527282, 37532692	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Associate	36064338	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	17082613, 17668204, 26851185, 27687306, 30473538, 30816121, 31879171, 31881010, 32005679, 32556504, 32700817, 33178836, 33274216, 33461176, 33934535, 34397869, 34517904, 34531868, 35090416, 35212236, 35837383, 35844446, 35918384, 36034461, 36457341, 36572999, 37164914, 37187527, 37532692, 37694354, 38177255, 38261568, 38594917, 39175022	★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Inhibit	29440769	★☆☆☆☆ Found in Text Mining only
Adenoma	Associate	12520084	★☆☆☆☆ Found in Text Mining only
Adenoma Islet Cell	Associate	31000755	★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Associate	32416752, 35297393	★☆☆☆☆ Found in Text Mining only
Adenomyosis	Associate	39456936	★☆☆☆☆ Found in Text Mining only
Adenoviridae Infections	Associate	27701670	★☆☆☆☆ Found in Text Mining only
Adiposis Dolorosa	Stimulate	34187516	★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Associate	34531868	★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Associate	25926555, 31445098, 33228556, 35611411	★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Associate	21198753	★☆☆☆☆ Found in Text Mining only
Aicardi Goutieres syndrome	Associate	23092122	★☆☆☆☆ Found in Text Mining only
AIDS Associated Nephropathy	Associate	19397801, 23982074, 26306690, 28453847	★☆☆☆☆ Found in Text Mining only
AIDS Associated Nephropathy	Inhibit	22693541	★☆☆☆☆ Found in Text Mining only
AIDS Dementia Complex	Associate	3091303	★☆☆☆☆ Found in Text Mining only
Airway Obstruction	Associate	15944327, 16246539	★☆☆☆☆ Found in Text Mining only
Allergic Fungal Sinusitis	Associate	38441343	★☆☆☆☆ Found in Text Mining only
Alopecia	Associate	37746940, 7930677	★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Associate	12125957, 27094591, 33807704	★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Stimulate	10337028	★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Associate	19842835, 27792269	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	23824053, 25197660, 34001857, 34804058, 35279225, 36246562, 37545529, 38301877, 39388354, 39523385, 39657893, 40560886	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Inhibit	25072319	★☆☆☆☆ Found in Text Mining only
Amelogenesis imperfecta hypoplastic hypomaturation X linked 1	Associate	36826109	★☆☆☆☆ Found in Text Mining only
Amenorrhea	Stimulate	20065129	★☆☆☆☆ Found in Text Mining only
Amyloidosis Primary Cutaneous	Associate	9347791	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Associate	28973548	★☆☆☆☆ Found in Text Mining only
Anal Gland Neoplasms	Associate	10195031	★☆☆☆☆ Found in Text Mining only
Anemia	Associate	25904736, 28426727	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Associate	11544283, 14675414, 15345281, 17463169, 1827129, 21506940, 22138514, 22797698, 24528288, 24845454, 26354756, 26764034, 28831064, 30889317, 32761514, 33785863, 9160674	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Stimulate	12404285	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Associate	10583274	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Associate	32267841	★☆☆☆☆ Found in Text Mining only
Aneurysm	Associate	1700620, 30686933	★☆☆☆☆ Found in Text Mining only
Angina Stable	Associate	28260995	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Associate	16799237, 24453425	★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Associate	12393451, 18034765	★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Associate	33747255	★☆☆☆☆ Found in Text Mining only
Anorexia	Associate	35586668	★☆☆☆☆ Found in Text Mining only
Anthropophobia	Associate	30941121, 33936110, 37031355, 40165131	★☆☆☆☆ Found in Text Mining only
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	12124874, 15762890, 24648606, 30157919, 30510966, 31921121, 36804380	★☆☆☆☆ Found in Text Mining only
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Inhibit	34289887	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Associate	10643701, 11535526, 11895785, 25862984, 28193831, 30872365	★☆☆☆☆ Found in Text Mining only
Anus Neoplasms	Associate	16757590, 23900552	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Associate	16297165	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Associate	16297165, 1700620, 29716755, 30686933, 39586133	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Associate	30810667, 30957625, 37883426	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Stimulate	32078016	★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Associate	34202072, 39991758	★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Associate	30810667	★☆☆☆☆ Found in Text Mining only
Aphasia Conduction	Inhibit	23667456	★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Associate	20130127	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis Obliterans	Associate	35757718	★☆☆☆☆ Found in Text Mining only
Arthralgia	Associate	24223933	★☆☆☆☆ Found in Text Mining only
Arthritis	Associate	21248258, 25113810, 27849614, 29193869, 33291545, 34108969, 35130317, 38123480	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Associate	30327490	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Associate	15743472, 15939793, 17374135, 18576332, 20127724, 21381000, 21702013, 21739422, 24470328, 25092890, 25833190, 26387944, 30089725, 33597588, 37445800, 37741520, 8093436	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Inhibit	36793127	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Associate	11160357, 16277694, 24286492, 24470327, 25113810, 28245522, 29112182, 31727095, 33452865, 34108969, 34309834, 34681660, 35087513, 39711043, 39930543, 39991156	★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Associate	10640771, 15547094, 17425604	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	10403931, 10513808, 10700427, 10728756, 11056676, 11207664, 11803732, 12115225, 12393721, 12428227, 12591902, 12695561, 12699431, 12847680, 12878725, 1347492, 1386608, 14726963, 15140775, 15457445, 15498047, 15535835, 15880821, 15899036, 15934068, 16200579, 16220542, 16277694, 16537805, 16838043, 17109473, 17200409, 17328044, 17565371, 17665008, 17907166, 18353171, 18512781, 19255426, 19394279, 19479869, 19843577, 19886735, 19904767, 20459811, 20465565, 20658292, 20727150, 20738421, 20824142, 20929536, 21155991, 21204897, 21314928, 22488116, 22532634, 22594821, 22649468, 23263488, 23280063, 23494522, 23619188, 24019115, 24022618, 24043759, 24313359, 24452947, 24742142, 24959711, 24968232, 25164131, 25433812, 25649145, 25738173, 25880754, 25960619, 26091715, 26147876, 26245356, 26314565, 26464634, 26604133, 27241313, 27314557, 27385284, 27434862, 27667787, 27700100, 27723282, 27915349, 28150777, 28253537, 28282368, 28535889, 28569167, 28751821, 29112182, 29193869, 29388193, 29472917, 29563614, 30106887, 30333237, 30402903, 30611306, 30753680, 30990587, 31006511, 31333666, 31338093, 31405169, 31727095, 31945409, 32111105, 32117312, 32264938, 32961930, 33117342, 33193313, 33362761, 33507149, 33799480, 34079550, 34108969, 34369364, 34580414, 34867944, 35023427, 35085847, 35523821, 35706043, 35967356, 36012570, 36062760, 36851682, 36902005, 37344505, 37809066, 37934808, 38216287, 39261837, 39290322, 39586747, 7683586, 7962553, 8621791, 8872162, 8898376, 9260157, 9301522, 9409647, 9754554, 9767455, 9826720	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Inhibit	10922071, 24223933, 30413189, 37647423	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Stimulate	14691302, 23165362, 28358698, 30052100, 31205958, 33291545, 35848477	★☆☆☆☆ Found in Text Mining only
Asbestosis	Associate	34022844	★☆☆☆☆ Found in Text Mining only
Ascites	Associate	12942579, 21203522, 30687337	★☆☆☆☆ Found in Text Mining only
Aspergillosis Allergic Bronchopulmonary	Associate	20714107	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	10596698, 10691908, 11510804, 17349011, 17409322, 17460949, 18250971, 18581330, 18832695, 19152963, 19610265, 21197090, 21469087, 21473777, 23893806, 24641294, 24934276, 26276877, 27230446, 27708065, 27848966, 27902892, 29297467, 29809062, 30087444, 30537802, 30644695, 32292999, 32532832, 33271553, 34576307, 34721414, 35029177, 35817495, 36194662, 36611927, 37431194, 38129444, 39745770, 39868576, 40551049, 9657564	★☆☆☆☆ Found in Text Mining only
Asymptomatic Infections	Associate	31566584	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Associate	10606975, 11427422, 14563948, 1972177, 20448385, 23264026, 2851398, 31866622, 34248969, 38155568	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	15731463, 17526997, 19406979, 20495843, 21677140, 22313962, 23469279, 24347824, 24453425, 25814626, 26383248, 26822994, 30872365, 32229536, 35428200, 35842645, 36820569, 36855107, 37881939	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Inhibit	24385687	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Associate	25810125, 35485359, 35600045	★☆☆☆☆ Found in Text Mining only
Atypical Squamous Cells of the Cervix	Associate	33605553, 36796230	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Associate	31591744	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Stimulate	37108638	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Associate	10400799, 10583274, 10739333, 11298351, 11390436, 11516335, 11602626, 11675346, 16424227, 16836768, 16917003, 17183685, 17463169, 17665008, 18000051, 18326816, 18490707, 18599794, 19074986, 19155519, 19162554, 19220836, 19283780, 19350181, 19604266, 20045101, 20370571, 20465565, 20498357, 21297967, 21508257, 21606346, 21926348, 21959269, 22461703, 22489829, 23432692, 23739916, 24376757, 24589341, 24968232, 25451162, 25556651, 25629163, 25824483, 25884400, 25894502, 26063731, 26106896, 26486970, 26764034, 27211045, 27619682, 27727279, 28150777, 28248954, 28253537, 28336414, 28393080, 28870212, 29066174, 29626493, 30632146, 31119949, 31205958, 31471951, 31612695, 31817224, 32646440, 32738192, 33128433, 33256375, 33291545, 33547171, 33893236, 34054801, 34095321, 34285924, 34605719, 35119226, 36674807, 37380713, 38054003, 39226901, 39261837, 39388354, 7635520, 7909242, 8626615, 9545531	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Inhibit	17615234, 19609102, 22392608, 28387597	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Stimulate	34631897	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Associate	11544282	★☆☆☆☆ Found in Text Mining only
Autoimmune enteropathy	Associate	23037630	★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Associate	11342444, 14592838, 17725802, 18566410, 19176318, 21183795, 24047902, 24894771, 27846610, 29686686, 31191551, 33170215, 34187243, 8642249	★☆☆☆☆ Found in Text Mining only
Autonomic Nervous System Diseases	Inhibit	25010330	★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Nocturnal Frontal Lobe Epilepsy	Associate	23553139	★☆☆☆☆ Found in Text Mining only
Axial Spondyloarthritis	Associate	25688074, 30755244	★☆☆☆☆ Found in Text Mining only
Bacterial Infections	Associate	26498252, 30233588, 8760835	★☆☆☆☆ Found in Text Mining only
Bacterial Infections	Stimulate	9030883	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Inhibit	35654816	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Associate	10403931, 15196263, 18685727, 21959269, 22385240, 23527071, 24574333, 24887071, 25410656, 27922688, 30971748, 32756992, 33142293, 35941595, 36226612, 37093132, 39838177, 8814751, 9067527	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Inhibit	26841832, 31614573	★☆☆☆☆ Found in Text Mining only
Berylliosis	Associate	11050177, 12438445, 12449171, 18250483, 19454729, 20299529, 24719461, 24995984	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Associate	10539886	★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Associate	37883426	★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Associate	35413272	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Associate	15128911, 17631149, 34918678	★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Associate	32878426	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Stimulate	31767892	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Associate	36676744	★☆☆☆☆ Found in Text Mining only
Birdshot Chorioretinopathy	Associate	24379648	★☆☆☆☆ Found in Text Mining only
Blastocystis Infections	Associate	37697423	★☆☆☆☆ Found in Text Mining only
Blister	Associate	15320912	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Associate	33974229	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Associate	29098565	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Associate	37809066	★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Associate	29472917	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Associate	15345281, 29415975	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Stimulate	24833097	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Associate	14691297, 15196256, 25917097, 29168181, 30305453, 37106402	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Inhibit	37848421	★☆☆☆☆ Found in Text Mining only
Brain Edema	Associate	30568305	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Associate	34244562	★☆☆☆☆ Found in Text Mining only
Brain Injuries Diffuse	Associate	28774302	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Associate	32974852, 37261085, 38267913	★☆☆☆☆ Found in Text Mining only
Breast Diseases	Associate	36380012	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	11466395, 12794115, 19596912, 22471961, 22678162, 23034170, 23169287, 23778140, 25605488, 25997452, 27117582, 27707838, 27727484, 30069490, 30221739, 30670769, 31408436, 31790361, 32222891, 32562536, 32810665, 33103515, 33145341, 33623115, 33767579, 33785258, 34386013, 34518441, 34531868, 34620015, 35373393, 35486183, 35603183, 35639264, 35819135, 36189580, 36207751, 36281185, 36376974, 36437379, 36528658, 37596527, 37940345, 38170155, 38181289, 38263363, 38266804, 39175074, 39218304, 39391306, 40142285, 7929817	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Inhibit	34365471	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Associate	28054583, 9828857	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Associate	24116927, 28257632, 31901157, 36561744	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans Syndrome	Stimulate	11698307	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans Syndrome	Associate	14604970, 14764530, 17889354, 18617642, 19505389, 21900196, 23607447, 25266000, 25460358, 26717145, 29197137, 30936059, 32382059, 33965183	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans Syndrome	Inhibit	15972448, 20628341	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Associate	25797206, 37507442	★☆☆☆☆ Found in Text Mining only
Brucellosis	Associate	20404074	★☆☆☆☆ Found in Text Mining only
Bruton type agammaglobulinemia	Associate	11877289, 22289994, 34489944	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Associate	12133989, 17521425, 20876453, 22162713, 24628049, 34668039, 7595225, 8695856	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Inhibit	34668039	★☆☆☆☆ Found in Text Mining only
Bursitis	Associate	36875119	★☆☆☆☆ Found in Text Mining only
Buruli Ulcer	Associate	28241036	★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	17724589	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Associate	14770079	★☆☆☆☆ Found in Text Mining only
Candidiasis	Associate	1720301	★☆☆☆☆ Found in Text Mining only
Capillary Leak Syndrome	Associate	9400611	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	24519063, 33941222, 36864443	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Associate	22382400	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Associate	27117439, 33623115	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Associate	22471961, 35776197	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	14716821, 15633209, 17372588, 17457217, 18793383, 20087354, 20686664, 20883314, 21419713, 22505239, 23223899, 23526963, 25907075, 26517519, 27136203, 29670256, 30116751, 31485637, 31903159, 32075608, 32170378, 32218692, 32626741, 32863381, 32945410, 33264420, 33426064, 33441885, 34221187, 34405225, 34424809, 34531868, 34769191, 34813686, 34980144, 35092558, 35123420, 35189839, 35321724, 35363194, 35833147, 35986302, 36211805, 36221095, 36536232, 36746728, 36938729, 37077908, 37089050, 37335078, 37371463, 37400463, 37881434, 39289669, 39738479, 39838375, 40410708, 7927492	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Inhibit	15180734	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Associate	40010639	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Associate	26249178, 32203210	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Associate	36263183	★☆☆☆☆ Found in Text Mining only
Carcinoma Neuroendocrine	Associate	37027114	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	14611679, 16421594, 20473949, 23098499, 24136748, 24761885, 25967708, 27000869, 27191652, 27244531, 27323163, 28187172, 28624781, 29991058, 30123214, 30505306, 31043415, 33385734, 33676448, 34603645, 35122478, 35131864, 35523765, 35831288, 36159860, 36281084, 36588094, 37402763, 37648263, 38062068, 39692573, 39870014	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Inhibit	29767245	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	19673890, 21829534, 22454499, 30485902, 31221207, 33914317, 35449092	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	24746181, 24797069, 25827621, 28898495, 33777046, 35655709, 35836806, 35987606, 36512410, 40410886	★☆☆☆☆ Found in Text Mining only
Carcinoma Papillary	Stimulate	39299443	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	10431690, 10944605, 12208877, 18004564, 19001137, 19238009, 19454729, 19609102, 1968360, 21300979, 25563193, 25824786, 30534127, 31431691, 32469992, 33322496, 33429832, 33619294, 34290908, 34402193, 34531868, 34795663, 36463235, 36611966, 36712923, 36793506, 38292868, 39348357, 9328129	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Stimulate	32277125	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Inhibit	33177244	★☆☆☆☆ Found in Text Mining only
Carcinoma Signet Ring Cell	Associate	36921674	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	12716470, 19596931, 21200385, 22402444, 25340823, 31881010, 34531868, 35195152, 35799269, 36703911, 36966704, 37164914, 37177979, 37415224, 9119748	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Stimulate	19220831, 20473949	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Associate	19623656	★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Associate	34876047	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Associate	22774985, 28543170	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Associate	19397801, 27974462, 28207945, 37967839	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy infantile histiocytoid	Associate	8627751	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Associate	34489963	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	30157919, 31275310, 32229536, 35292700, 37166484, 40649979	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Stimulate	34360781	★☆☆☆☆ Found in Text Mining only
Carney Complex	Associate	37151356	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Associate	33480285, 36304068, 37644056	★☆☆☆☆ Found in Text Mining only
Carrington syndrome	Associate	7489791	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Associate	27241313	★☆☆☆☆ Found in Text Mining only
Castleman Disease	Associate	37175521	★☆☆☆☆ Found in Text Mining only
Cataplexy	Inhibit	17665008	★☆☆☆☆ Found in Text Mining only
Cataract	Associate	24785834	★☆☆☆☆ Found in Text Mining only
CD59 Deficiency	Associate	16277694, 26870823, 33836874	★☆☆☆☆ Found in Text Mining only
CD8 Deficiency Familial	Associate	21546492	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Associate	10784586, 12324465, 17307878, 19351412, 22785229, 23326425, 23571506, 23874626, 23878218, 24968232, 26838051, 28049849, 28166225, 28283419, 29191561, 31457091, 31628754, 3261663, 33057065, 33654213, 33927210, 33927715, 34495570, 34618841, 34895167, 34960101, 35119226, 35371081, 35995787, 38415552	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Inhibit	25465638	★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Associate	23409198, 24282598, 2783859	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Associate	27884769, 32344922, 35962388	★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Associate	37459093	★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Associate	17635814, 29160519, 29473686	★☆☆☆☆ Found in Text Mining only
Chagas Disease	Associate	22774985, 28543170, 29160519	★☆☆☆☆ Found in Text Mining only
Charcot Marie Tooth disease Type 2B	Associate	36453923	★☆☆☆☆ Found in Text Mining only
Chemical and Drug Induced Liver Injury	Associate	10209518, 23305119, 25786446, 28257599	★☆☆☆☆ Found in Text Mining only
Chemke Oliver Mallek syndrome	Associate	29039547	★☆☆☆☆ Found in Text Mining only
Chlamydia Infections	Associate	29287991	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	39359389, 40410708	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Associate	24726754, 28597951, 37256725, 38199298	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Stimulate	33095470	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Extraskeletal Myxoid	Stimulate	26104913	★☆☆☆☆ Found in Text Mining only
Chorioamnionitis	Associate	25797206, 27870827, 31912179	★☆☆☆☆ Found in Text Mining only
Choroidal Effusions	Stimulate	18925324	★☆☆☆☆ Found in Text Mining only
Choroidal Effusions	Associate	9099924	★☆☆☆☆ Found in Text Mining only
Chromosome 6 ring syndrome	Associate	10203105	★☆☆☆☆ Found in Text Mining only
Chromosome Deletion	Associate	39891996	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Associate	19394279, 22647666, 23012327, 23508476, 24136005, 24935928, 30700717, 37863732	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Disease Mineral and Bone Disorder	Associate	25484131	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Associate	1834575	★☆☆☆☆ Found in Text Mining only
Chronic Urticaria	Associate	32899053, 33801296, 35371000, 36713372	★☆☆☆☆ Found in Text Mining only
Churg Strauss Syndrome	Associate	20729468, 21484763	★☆☆☆☆ Found in Text Mining only
Clear cell metastatic renal cell carcinoma	Associate	11862476, 36396738	★☆☆☆☆ Found in Text Mining only
Cleft Lip	Associate	25139022	★☆☆☆☆ Found in Text Mining only
Coagulation Protein Disorders	Associate	14521599	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Associate	19220836, 39657893	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Associate	37373554	★☆☆☆☆ Found in Text Mining only
Coinfection	Associate	11211316, 24520951, 32229536, 32937024	★☆☆☆☆ Found in Text Mining only
Coinfection	Stimulate	17957262	★☆☆☆☆ Found in Text Mining only
Colitis	Associate	11298351, 20465565, 35707543, 39210005	★☆☆☆☆ Found in Text Mining only
Colitis	Inhibit	23695510, 9743220	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	12699425, 1889695, 19292766, 19318319, 25144293, 25386078, 25526204, 26333292, 26345973, 26522261, 26589955, 28453768, 29512372, 31191543, 31206576, 31330513, 31356607, 32210709, 32908909, 33907256, 35876170, 36746519, 37055495, 37273534, 37788725, 39586377	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Inhibit	17602351, 9743220	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Stimulate	9071939, 9329971, 9824577	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	22319577, 30013992, 35445138, 37370088, 37626132, 37770581	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	10602890, 12695859, 14612896, 14968119, 17122624, 17510400, 21179245, 22276195, 22408358, 2365056, 23955802, 24064667, 24833093, 25268580, 25445815, 27110571, 27619682, 27682874, 28210081, 29020986, 29992127, 30013992, 31351430, 31354723, 31488881, 31921188, 32571262, 33101776, 33229508, 33413474, 33818637, 33868236, 34357372, 34717544, 34938284, 35127345, 35262923, 35292828, 35321516, 36063748, 36633318, 37483596, 37800782, 38364976, 38415552, 38583239, 39508845, 40001057, 40069612, 40274385, 40312697	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Inhibit	33625532	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	29710228	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Associate	10403927, 11876763, 14616794, 16412063, 17223965, 17302902, 19162554, 23039891, 23432692, 25225461, 25295286, 25926555, 26684629, 28054583, 29083052, 31445098, 32174910, 32575504, 3289139, 33193371, 34247288, 35305035, 38129593, 8666443, 9367399	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Inhibit	12165093, 1638763, 24130688, 29345621, 37086677, 8100719	★☆☆☆☆ Found in Text Mining only
Communicable Diseases	Associate	10330445, 11516335, 18256187, 19040613, 21059769, 28705256, 32873094	★☆☆☆☆ Found in Text Mining only
Condylomata Acuminata	Associate	37053156	★☆☆☆☆ Found in Text Mining only
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	29517683	★☆☆☆☆ Found in Text Mining only
Conjunctivitis Allergic	Associate	24368924, 25999672, 33114004, 36272417	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Associate	10331508, 17919564, 24419807	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Inhibit	11882051	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	18832677, 21889313, 22645426, 25001165, 35776197, 36077273, 36865544, 40508061	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Associate	18832677, 35478415, 36060667	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Stimulate	24167372	★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Associate	37325628	★☆☆☆☆ Found in Text Mining only
Cough	Inhibit	27383318	★☆☆☆☆ Found in Text Mining only
Cough	Associate	34719421	★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	32217834, 32217835, 32307550, 32405080, 32492530, 32574309, 32592406, 32598880, 32644266, 32679621, 32864865, 32866033, 32983106, 33096020, 33128792, 33178207, 33178221, 33193384, 33220925, 33237528, 33473155, 33692788, 33717140, 33741750, 33905951, 33937096, 33945513, 33993490, 34157486, 34427670, 34619994, 34764490, 34895167, 34965282, 35011632, 35090598, 35114198, 35154116, 35237272, 35336918, 35364330, 35398299, 35567391, 35663467, 35670811, 35675811, 35741107, 35764965, 35842705, 35880744, 35911689, 35980979, 36217141, 36232381, 36305225, 36414950, 36420584, 36562254, 36814840, 36855103, 37222960, 37302069, 37358499, 37483627, 37730638, 37762093, 37848421, 38077321, 39205152, 39205185, 39337460, 39355257, 39497098, 39510135, 40190436, 40299994	★☆☆☆☆ Found in Text Mining only
COVID 19	Inhibit	32425950, 32950268, 33041191, 33154753, 33677468, 34392110, 34716309, 34838183, 35698744, 36197228, 36946852, 39679195	★☆☆☆☆ Found in Text Mining only
COVID 19	Stimulate	35688805, 35851312, 36102684, 36430210	★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Inhibit	12174361	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Associate	36091021	★☆☆☆☆ Found in Text Mining only
Crazy paving pattern	Associate	36029220	★☆☆☆☆ Found in Text Mining only
Critical Illness	Inhibit	33041191	★☆☆☆☆ Found in Text Mining only
Critical Illness	Associate	37965255	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	11709514, 12699425, 15020649, 15306587, 15306590, 16045746, 19289577, 19318319, 20298123, 2101599, 22128034, 22167015, 23232296, 24681654, 24935928, 25761185, 27267052, 29453928, 29489879, 31158273, 31191543, 31968593, 33298614, 33313682, 35760777, 36746519, 37280154, 37550393, 37586415, 37752523, 38090774, 38211712, 9060820, 9071939, 9329971, 9422543	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Stimulate	23695510	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Inhibit	9743220	★☆☆☆☆ Found in Text Mining only
Cryptococcosis	Associate	26871820, 35720334	★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Associate	10504398	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Associate	24911279, 25803862	★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Associate	34399738, 35589692, 40435311	★☆☆☆☆ Found in Text Mining only
Cytokine Release Syndrome	Associate	16585607, 18373702, 22235276, 24585897, 34344350, 37373554, 37794597, 39281206	★☆☆☆☆ Found in Text Mining only
Cytomegalovirus Infections	Associate	11559831, 12010789, 12149221, 12662301, 12759463, 14645006, 17158960, 17183685, 17328033, 17553885, 18173357, 18454861, 18471037, 19539220, 20034645, 20562332, 21115690, 21526194, 22182806, 22539948, 22865914, 23258923, 23777765, 24130889, 24148296, 24465619, 24594993, 25008818, 25275464, 25974183, 26603521, 27460884, 27606804, 27821506, 28338007, 28683106, 28972094, 29491459, 30157919, 32229536, 32891157, 33301425, 33597150, 36865544, 37086677, 38512581, 38642678, 40004169, 7708976	★☆☆☆☆ Found in Text Mining only
Cytomegalovirus Infections	Inhibit	19747638	★☆☆☆☆ Found in Text Mining only
Cytomegalovirus Infections	Stimulate	31019052	★☆☆☆☆ Found in Text Mining only
Cytomegalovirus Retinitis	Associate	18173357	★☆☆☆☆ Found in Text Mining only
Dacryocystitis	Associate	27358392	★☆☆☆☆ Found in Text Mining only
Death	Associate	1402655, 15503313, 18456875, 19040613, 20663947, 21789236, 24646462, 27016692, 31401307, 33362757, 34154423, 35740993, 36555549	★☆☆☆☆ Found in Text Mining only
Death	Inhibit	21200385	★☆☆☆☆ Found in Text Mining only
Death	Stimulate	35287794	★☆☆☆☆ Found in Text Mining only
deficiency of adenosine deaminase 2	Associate	36248833	★☆☆☆☆ Found in Text Mining only
Deltaretrovirus Infections	Associate	1370929, 23409198, 27282836, 29723784, 39339919	★☆☆☆☆ Found in Text Mining only
Dementia	Associate	15890908	★☆☆☆☆ Found in Text Mining only
Dental Plaque	Associate	16799237	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Associate	15361220, 23110234	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Inhibit	18276105	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Associate	33112414, 37086677, 37327287	★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Associate	12060402, 19657353, 31148973	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	11069080, 11511293, 11720173, 16354184, 16484990, 16782037, 1714926, 18007580, 19439349, 22686584, 22968402, 26288354, 27448748, 29703987, 31511620, 33093567, 33807704, 35576187, 35743308, 37330465	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Stimulate	31205958	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Inhibit	39196303	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Associate	12653839, 21197090	★☆☆☆☆ Found in Text Mining only
Dermatomycoses	Associate	37128909	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Associate	15829578, 19953283, 24441329, 29172719, 29494763, 30157932, 33413573, 33675790, 35711463, 35762881, 35799782	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Stimulate	19949654	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Inhibit	36203592	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Associate	36513052	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Stimulate	17526997	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	31995625, 35154512, 35727147, 36077273, 36600150, 36865544, 37773841, 38408622, 8700877	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Insulin Dependent 7	Stimulate	34346755	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	15030582, 15182254, 15358643, 15667574, 16030184, 16260488, 1696864, 17032246, 17206281, 18248531, 18803760, 19037920, 19180473, 19654878, 19875613, 20045101, 20498357, 21896932, 22332874, 23390544, 24239002, 24348676, 24376757, 24523574, 24968232, 24973447, 25421756, 25523632, 25652388, 25682896, 26518356, 26631741, 26714416, 26888215, 27181214, 27629486, 28024918, 28248954, 28566371, 28645874, 29176645, 29229565, 29791073, 30619245, 30650147, 30723474, 31110501, 31511930, 32060144, 32248243, 32878069, 34127860, 35007320, 35022272, 35142878, 35626661, 36169248, 36201618, 36477008, 37040399, 37309552, 37432736, 37751304, 8082309, 9294207	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Stimulate	17100770, 23915345, 3280182	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Inhibit	24677179, 31299986	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	17526997, 27459386, 29107298, 29752628, 30044774, 30270447, 36940958, 36945068, 40080435	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Stimulate	25363329, 30574794	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Inhibit	30652669	★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Associate	11369787, 27606804	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Associate	34506229	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Inhibit	39290701	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Associate	40214234	★☆☆☆☆ Found in Text Mining only
Dianzani autoimmune lymphoproliferative syndrome	Associate	24894771, 31191551	★☆☆☆☆ Found in Text Mining only
Diarrhea	Associate	22873400, 35398299, 35586668	★☆☆☆☆ Found in Text Mining only
Diffuse panbronchiolitis	Associate	9030883	★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Associate	19040613, 21323691, 31297990, 31322747, 37006241	★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Inhibit	20141355, 30949166	★☆☆☆☆ Found in Text Mining only
Disease	Associate	10601054, 10759761, 12942579, 15864353, 1828397, 19737237, 22471282, 25421756, 26444573, 31839959	★☆☆☆☆ Found in Text Mining only
Disease	Stimulate	11119267, 3261663	★☆☆☆☆ Found in Text Mining only
Disease Progression	Stimulate	32203221	★☆☆☆☆ Found in Text Mining only
Disease Progression	Associate	37349318	★☆☆☆☆ Found in Text Mining only
Disease Resistance	Associate	24422906, 25889017	★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Associate	23037630	★☆☆☆☆ Found in Text Mining only
Dissociative Identity Disorder	Stimulate	22808957	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Associate	22861363, 31699819	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Inhibit	35222360	★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Associate	1373352, 16354184, 17349011, 19657353, 20635785, 24116013, 24338253, 24391521, 25093709, 33114004, 33662368, 34673799, 38203472, 38441343, 9241767, 9378492, 9714417	★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Inhibit	22092655, 34257142	★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	10780664, 1713198, 18832677, 20686664, 23302373, 25484131, 26870823, 27136203, 27324616, 27606804, 28331088, 29476109, 29669829, 30842324, 31250942, 31417563, 32382059, 32497499, 35007320, 36171010, 37161048, 39210005, 7474110, 8095828, 9767455, 9920842	★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Stimulate	29027667	★☆☆☆☆ Found in Text Mining only
Drug Resistant Epilepsy	Associate	23782115, 24164431, 26584666, 27061881, 29244809, 31266818, 31479466, 32183889, 32692778, 33478415, 34622550, 35917929, 37327289, 40253369	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Associate	32183889, 33855355	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Associate	12738386, 15618192	★☆☆☆☆ Found in Text Mining only
Dysbiosis	Associate	30171206, 33707430	★☆☆☆☆ Found in Text Mining only
Dysentery	Associate	28854225	★☆☆☆☆ Found in Text Mining only
Dysentery Bacillary	Associate	8991634	★☆☆☆☆ Found in Text Mining only
Dyserythropoiesis Congenital with Internuclear Chromatin Bridges and Ultrastructurally Normal Erythroblast Heterochromatin	Associate	10691859	★☆☆☆☆ Found in Text Mining only
Dysferlinopathy	Associate	19949654, 26045819	★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Associate	32452087	★☆☆☆☆ Found in Text Mining only
Dyskinesia Drug Induced	Associate	40495522	★☆☆☆☆ Found in Text Mining only
Dyskinesia Familial with Facial Myokymia	Stimulate	21079332	★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus Syndrome	Associate	34919260	★☆☆☆☆ Found in Text Mining only
Dyspnea	Associate	36197228	★☆☆☆☆ Found in Text Mining only
Dystonic Disorders	Stimulate	32416752	★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia Anhidrotic with Immunodeficiency Osteopetrosis and Lymphedema	Associate	35479072	★☆☆☆☆ Found in Text Mining only
Ectrodactyly cardiopathy dysmorphism	Associate	29396927	★☆☆☆☆ Found in Text Mining only
Eczema	Associate	22092655, 24116927	★☆☆☆☆ Found in Text Mining only
Embolism	Inhibit	27084711	★☆☆☆☆ Found in Text Mining only
Emphysema	Associate	24805101, 30335480, 33936110	★☆☆☆☆ Found in Text Mining only
Encephalitis	Associate	17060473, 31332390, 32109548, 32744608	★☆☆☆☆ Found in Text Mining only
Encephalitis Tick Borne	Associate	31924650	★☆☆☆☆ Found in Text Mining only
Encephalomyelitis	Associate	34215689	★☆☆☆☆ Found in Text Mining only
Encephalomyelitis Autoimmune Experimental	Associate	21281812	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	25931171, 28300844, 32066405, 32339157, 35693634, 36207751, 36581331, 36881401	★☆☆☆☆ Found in Text Mining only
Endometriosis	Associate	25275597, 30325236, 31615517, 31941945, 37081668	★☆☆☆☆ Found in Text Mining only
Endometritis	Associate	34671363	★☆☆☆☆ Found in Text Mining only
Endotoxemia	Associate	25225461	★☆☆☆☆ Found in Text Mining only
Enterobacteriaceae Infections	Associate	33275070	★☆☆☆☆ Found in Text Mining only
Enterocolitis	Associate	22267598	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Associate	31801814	★☆☆☆☆ Found in Text Mining only
Enteropathy Associated T Cell Lymphoma	Associate	22654438, 26474755	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Associate	16219537, 17166416, 32849632, 8642249	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Associate	37699081	★☆☆☆☆ Found in Text Mining only
Ependymoma	Associate	19917695	★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Associate	35202881	★☆☆☆☆ Found in Text Mining only
Epilepsy Generalized	Associate	40495522	★☆☆☆☆ Found in Text Mining only
Epilepsy Post Traumatic	Associate	8100745	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Associate	32744608	★☆☆☆☆ Found in Text Mining only
Epilepsy Tonic Clonic	Associate	36104359	★☆☆☆☆ Found in Text Mining only
Epstein Barr Virus Infections	Associate	10864684, 11504544, 14694109, 1672270, 23442890, 23569328, 34882759, 35215762, 35315593, 38078808, 7909607, 8995705	★☆☆☆☆ Found in Text Mining only
Epstein Barr Virus Infections	Stimulate	31205958	★☆☆☆☆ Found in Text Mining only
Erosive Adenomatosis of the Nipple	Associate	18489537	★☆☆☆☆ Found in Text Mining only
Erythema Infectiosum	Associate	28358698	★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Associate	28991896	★☆☆☆☆ Found in Text Mining only
Escherichia coli Infections	Associate	22403314	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	23082063, 27577071, 38065897, 40587482	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	23889244, 28949934, 32317292, 34616847	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Associate	36891527	★☆☆☆☆ Found in Text Mining only
Evans Syndrome	Associate	34424963	★☆☆☆☆ Found in Text Mining only
Exanthema	Associate	20646339	★☆☆☆☆ Found in Text Mining only
Factor 8 deficiency acquired	Associate	12911593	★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Associate	15544632	★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Associate	33478117, 36555549, 36899621	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Associate	28557197	★☆☆☆☆ Found in Text Mining only
Fatigue	Associate	35586668	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Stimulate	21619669, 27001659	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Associate	23514202, 26032326, 26370228, 39394558	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Inhibit	29867995	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Associate	26806136	★☆☆☆☆ Found in Text Mining only
Febrile Neutropenia	Inhibit	15503313	★☆☆☆☆ Found in Text Mining only
Fever	Associate	33128792	★☆☆☆☆ Found in Text Mining only
Fibrolamellar hepatocellular carcinoma	Associate	36302754	★☆☆☆☆ Found in Text Mining only
Fibromyalgia	Associate	32582603	★☆☆☆☆ Found in Text Mining only
Fibrosis	Inhibit	18726940	★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	20462651, 20883314, 22252758, 23446058, 26754349, 28054583, 28376292, 33912168, 35364330, 35903097, 37002627, 39276679	★☆☆☆☆ Found in Text Mining only
Fibrous Dysplasia Polyostotic	Associate	28827283, 29850635, 30585624	★☆☆☆☆ Found in Text Mining only
Folate Malabsorption Hereditary	Stimulate	15322179	★☆☆☆☆ Found in Text Mining only
Food Hypersensitivity	Associate	24762976, 30120223	★☆☆☆☆ Found in Text Mining only
Fractures Closed	Inhibit	28591184	★☆☆☆☆ Found in Text Mining only
Frailty	Associate	32187205, 37254268	★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Associate	23891730	★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Associate	35060553	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Associate	34185421	★☆☆☆☆ Found in Text Mining only
Gastritis	Associate	27306341, 32974219, 34589088, 38366919, 9784570	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Associate	12942579, 26516200	★☆☆☆☆ Found in Text Mining only
Gastroschisis	Associate	31145102	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Associate	11328295, 12548603, 15054822, 15832009, 33526873, 35523765	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Associate	10389595, 15916690	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Inhibit	27855396	★☆☆☆☆ Found in Text Mining only
general anxiety disorder	Associate	38264647	★☆☆☆☆ Found in Text Mining only
Genetic Diseases Inborn	Associate	12174361	★☆☆☆☆ Found in Text Mining only
Genetic Diseases Inborn	Inhibit	33471124	★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Associate	38165703	★☆☆☆☆ Found in Text Mining only
Germinoma	Associate	36259639	★☆☆☆☆ Found in Text Mining only
Germinoma	Stimulate	39958339	★☆☆☆☆ Found in Text Mining only
Gerodermia osteodysplastica	Associate	25309050	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Associate	14672892, 22147555, 30037347, 31379838, 34583923, 35003111, 37435729, 37952293, 39436725, 40095634, 8113687	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Stimulate	33095470	★☆☆☆☆ Found in Text Mining only
Gingivitis	Associate	34234776	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	16723631, 1848799, 18490770, 19028999, 22937035, 24570975, 25555571, 26578623, 28412740, 28880903, 30299157, 30568305, 31451090, 33449451, 34531868, 35599254, 35969754, 35994815, 38057698, 39513882	★☆☆☆☆ Found in Text Mining only
Glioma	Associate	17066899, 17216339, 1836455, 18577234, 24375192, 24691423, 26578623, 28620836, 31690954, 33140187, 34531868, 35720326, 35812432, 36325335, 36714574	★☆☆☆☆ Found in Text Mining only
Glioma of Brain Familial	Associate	34531868	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Associate	34876047	★☆☆☆☆ Found in Text Mining only
Gliosis	Associate	32744608	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Associate	20506525	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Stimulate	1982451, 20484297	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Associate	32085673, 34823491, 35351150, 35528619, 37752523, 7908616, 7996808	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Inhibit	36059518	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Associate	15954921, 37974210	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Associate	33059348	★☆☆☆☆ Found in Text Mining only
Glucose Intolerance	Associate	30941121, 37711619	★☆☆☆☆ Found in Text Mining only
Glucosephosphate Dehydrogenase Deficiency	Associate	25793728	★☆☆☆☆ Found in Text Mining only
Glut1 Deficiency Syndrome	Stimulate	37431194	★☆☆☆☆ Found in Text Mining only
Glutathione Peroxidase Deficiency Hemolytic Anemia possibly due to	Associate	8288627	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease 0 Muscle	Associate	10539886	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Associate	28389590	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Inhibit	33267869	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Associate	9472657	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Associate	34289887	★☆☆☆☆ Found in Text Mining only
Gout	Associate	36550178	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Associate	10516610, 12946996, 15284108, 15327522, 15459005, 16038781, 16443514, 16681643, 19505389, 20302964, 21835147, 25300871, 25543092, 26327693, 27812545, 28746369, 30894856, 31205958, 33133081, 34657151, 35015822, 36056390, 36071219, 7670118, 8063938	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Stimulate	12780786, 16792671, 33226726	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Inhibit	19912254, 23226545, 24859877	★☆☆☆☆ Found in Text Mining only
Granuloma	Associate	12000723, 24177566, 32744608, 33720848	★☆☆☆☆ Found in Text Mining only
Granuloma Annulare	Associate	12060389	★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Associate	11562512, 11678911, 12000723, 12716450, 14764530, 15147365, 16837919, 16918819, 20113371, 21484763, 22490506, 28615072, 35039330, 37086441, 9764612	★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Stimulate	28040323, 36613701	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Associate	8881751	★☆☆☆☆ Found in Text Mining only
Graves Disease	Associate	10780664, 15147360, 19240157, 22216337, 24478186, 25940130, 29259988, 2962792, 30938833, 31554206, 33980771, 34616359, 35220890, 35720300, 39388354, 7900942, 8025214, 9545531, 9546811	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Inhibit	23249428, 27206624	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Stimulate	30956992, 33987447, 40155866	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Ophthalmopathy	Associate	10781517, 15148216, 27349268, 28485799, 29974826, 32176314, 38536014, 39234250, 39689341	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Stimulate	19419934	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Inhibit	37875358	★☆☆☆☆ Found in Text Mining only
HAIR AN syndrome	Associate	29992171, 30996137	★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome Multiple	Inhibit	27477328	★☆☆☆☆ Found in Text Mining only
Hand Foot and Mouth Disease	Associate	24939221	★☆☆☆☆ Found in Text Mining only
Hand Foot Syndrome	Associate	35586668	★☆☆☆☆ Found in Text Mining only
Hantavirus Pulmonary Syndrome	Associate	9400611	★☆☆☆☆ Found in Text Mining only
Harlequin type ichthyosis	Associate	34614112	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Inhibit	21147625, 23249428, 27206624	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Associate	24478186, 25940130, 39508448	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Stimulate	35720300, 7994911	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Associate	20857101, 28945296, 7790320	★☆☆☆☆ Found in Text Mining only
Heart Arrest	Associate	36930329	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Associate	39281206	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Associate	17635814, 18617642, 22574131, 29160519, 29473686, 30379878, 38116006	★☆☆☆☆ Found in Text Mining only
Heart Failure	Associate	18037740, 20462651, 25984539, 34857156, 36555549, 37390254	★☆☆☆☆ Found in Text Mining only
Heart Failure	Inhibit	21935395	★☆☆☆☆ Found in Text Mining only
Heart Failure	Stimulate	28838148	★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Associate	23417848, 28143491	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Associate	10583274	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Associate	12483012, 29122757, 36341566, 40028321	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Associate	15086421	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Associate	15730400	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Stimulate	19406979	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Associate	18034765, 29444872, 36936969	★☆☆☆☆ Found in Text Mining only
Hemophilia B	Stimulate	10354153	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Associate	36855107	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Associate	28751644, 36293192	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Associate	31494259	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Associate	28597951, 29358858, 30600293, 31422415, 36159854, 36841352, 37290592	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Associate	23032418, 24672661, 25786446, 26173605, 28591184, 34177894, 35458518, 36635631	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Inhibit	28231294	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Associate	15996036, 22978653, 28606013	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Inhibit	28231294	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Associate	15865084, 17034579, 17601623, 20710056, 24465502, 24489961, 24760894, 29120899, 31952232, 32750098, 33912168, 34930041, 36405960, 9227171	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Stimulate	22671952, 23555014	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Inhibit	27183178, 34474121	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Associate	24130824, 32994477, 33912168	★☆☆☆☆ Found in Text Mining only
Hepatitis Viral Human	Stimulate	10858179	★☆☆☆☆ Found in Text Mining only
Hepatitis Viral Human	Associate	37207191	★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Associate	26684629	★☆☆☆☆ Found in Text Mining only
Hereditary Autoinflammatory Diseases	Associate	20498355	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30206415, 33367520	★☆☆☆☆ Found in Text Mining only
Hereditary leiomyomatosis and renal cell cancer	Associate	18684866, 20876453, 26722524, 28893733, 9710220	★☆☆☆☆ Found in Text Mining only
Heredodegenerative Disorders Nervous System	Associate	15136590, 15864353, 18190256	★☆☆☆☆ Found in Text Mining only
Herpes Simplex	Stimulate	17957262	★☆☆☆☆ Found in Text Mining only
Herpes Simplex	Associate	28201724	★☆☆☆☆ Found in Text Mining only
Herpes Zoster	Associate	24352459, 35720399	★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Associate	27206704	★☆☆☆☆ Found in Text Mining only
Histiocytosis Langerhans Cell	Associate	3280696	★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	10193417, 10200305, 10361239, 10375528, 10419894, 10444267, 10447730, 10469055, 10556193, 10559275, 10607709, 10671214, 10693824, 10775581, 10910888, 11023494, 11032864, 11086107, 11122240, 11437669, 11495299, 11529919, 11544282, 11559831, 11566623, 11604406, 11699717, 11734634, 11861282, 11882044, 11982603, 11986255, 12059946, 12200381, 12218162, 12402403, 12409732, 12434018, 12522039, 12534962, 12709027, 12730375, 12931750, 12970422, 12974761, 1349271, 1371493, 14632751, 1475186, 14764521, 14963124, 1501285, 15059846, 15067030, 15173593, 15194057, 15252446, 15271794, 15373912, 15457680, 15527839, 15542635, 15705786, 15753288, 15864345, 15892963, 15905189, 15980151, 15987650, 16011533, 16046522, 16246391, 16260021, 16421946, 16505369, 1671082, 16796525, 16928758, 16935861, 17005693, 17005700, 17035326, 17051525, 1706342, 17065205, 17092330, 1709701, 17110377, 17147468, 17182676, 17229711, 17257057, 17263642, 17465678, 17474134, 17688698, 17709553, 17928354, 17957262, 18025239, 18036256, 18372341, 18376407, 18379725, 18414671, 18454861, 18484654, 18490721, 18550667, 18617991, 18684102, 18692772, 18821942, 18845823, 18928553, 18941536, 18981766, 19005268, 19131896, 19165342, 19178925, 19182922, 19194312, 19239367, 19251297, 19295330, 19299747, 19303366, 19381272, 19390419, 19406689, 19432547, 19723616, 19797156, 19918060, 19952713, 20001317, 20132229, 20147631, 20162549, 20186035, 20299954, 20433405, 20656923, 20660788, 20710056, 20715931, 20847379, 20862322, 20926955, 21059891, 21111238, 21115690, 21118300, 21124822, 21171992, 21257970, 21298072, 21343147, 21347267, 21352200, 21403397, 21410942, 21494598, 21526194, 21592997, 21666058, 21690402, 21740673, 21819256, 21840929, 21902583, 21912648, 21940422, 2200889, 22027639, 22044858, 22114342, 22141397, 22156200, 22166560, 22182806, 22205964, 22215422, 22240256, 22287716, 22312424, 22313962, 22319447, 22345473, 22359615, 22363505, 22378925, 22398371, 22400042, 22438246, 22444912, 22457278, 22470433, 22471284, 22676378, 22687513, 22715399, 22735071, 22739389, 22768122, 22792231, 22808957, 22866663, 22921314, 23029209, 23029309, 23032418, 23092122, 23129528, 23171203, 23185351, 23242319, 23254284, 23258923, 23382191, 23382678, 23392455, 23442890, 23516360, 23520522, 23566249, 23585827, 23588134, 23614015, 23635305, 23637601, 23658518, 23707169, 23721325, 23724012, 23782115, 23806696, 2384919, 23884411, 23931628, 23965471, 24005375, 24047762, 24091694, 24284880, 24304582, 24335483, 24356113, 24378728, 24422906, 24465619, 24483185, 24497824, 24497828, 24498878, 24499954, 24520951, 24522925, 24554663, 24558379, 24585897, 24661998, 2470786, 24722454, 24752012, 24759207, 24785834, 24785950, 24797997, 24828336, 24829350, 24834865, 24871455, 24875931, 24942581, 24947188, 24961156, 25053368, 2511174, 25193656, 25197078, 25314253, 25329064, 25333710, 25495598, 25611551, 2564677, 25647167, 2572607, 25786446, 25808800, 25809693, 25859596, 25924764, 25974183, 26018157, 26068923, 26178998, 26291824, 26339043, 26402620, 26452480, 26559763, 26584215, 26627102, 26650393, 26666875, 26676775, 26678998, 26696749, 26754349, 26762145, 26764036, 26776123, 26807971, 26842474, 26842479, 26854806, 26883727, 26889036, 26927799, 26939770, 26962229, 27073222, 27082643, 27082982, 27124305, 27145859, 27163710, 27183178, 27191978, 27280548, 27281071, 27384654, 27401039, 27415008, 27506421, 27509243, 27525551, 27531931, 27536983, 27630231, 27795436, 27821902, 2783372, 27865749, 27870882, 27875993, 27898686, 27932619, 27981723, 27986677, 27992415, 28031466, 28076376, 28077629, 28077659, 28132517, 28181541, 28222782, 28225449, 28299915, 28331180, 28338007, 28484257, 28486838, 28509877, 28539453, 28591184, 28604824, 28615199, 28698276, 28744024, 28857825, 28892135, 28972094, 29029206, 29048352, 29115572, 29246111, 29367348, 29474461, 2950525, 29518102, 29538651, 29577368, 29636753, 29643247, 29652923, 29746296, 29800425, 29867928, 29915583, 29992171, 30005016, 30053296, 30063722, 30157873, 30171206, 30193823, 30197641, 30198299, 30285810, 30320604, 30344003, 30355686, 30379878, 3047430, 30522500, 30653393, 30662943, 30700725, 30735686, 30809229, 30857592, 30914509, 30917149, 30921390, 30936293, 30941121, 30979916, 30996137, 31107306, 31118081, 31118290, 31189571, 31208153, 31270222, 31277610, 31308388, 31396221, 31415590, 31440240, 31475647, 31497018, 31511383, 31511615, 31519219, 31533030, 31536177, 31550271, 31552706, 31593126, 31772057, 31781094, 31796951, 32019634, 32029589, 32093678, 32161179, 32196533, 32229536, 32241262, 32268275, 32282853, 32295609, 32295913, 32305135, 32350074, 32353080, 32379159, 32496542, 32579550, 32654992, 32750098, 32762760, 32828803, 32899621, 32907975, 32946499, 32954948, 33007050, 33073673, 33166790, 33310773, 33322496, 33477692, 33587445, 33605553, 33643305, 33720048, 33757177, 33776993, 33832435, 33867524, 33952659, 33974229, 33976386, 34017335, 34037423, 34076482, 34149690, 34237254, 34249000, 34320023, 34344350, 34370780, 34389623, 34425224, 34449812, 34465136, 34614112, 34618690, 34672108, 34712231, 34844430, 34845066, 34858437, 34870928, 34896288, 34938286, 34987521, 35042816, 35081977, 35106507, 35258402, 35412343, 35418589, 35429609, 35458559, 35499323, 35738253, 35787792, 35880744, 35941737, 35967422, 36150362, 36361228, 36380676, 36411423, 36443691, 36462403, 36536105, 36569851, 36599978, 36693889, 36820829, 36971588, 37030290, 37216549, 37430239, 37824079, 37949879, 38049910, 38067117, 38226493, 38267841, 39224595, 39466061, 39690095, 40003876, 40061947, 40149968, 7474129, 7500020, 7539037, 7570415, 7587726, 7587741, 7738172, 7851009, 7902137, 7907956, 8082291, 8099857, 8103715, 8137540, 8171003, 8603515, 8675212, 8697632, 8806559, 8906753, 8911139, 8918576, 8946943, 9010252, 9045868, 9056736, 9104824, 9108384, 9119998, 9144377, 9223523, 9226175, 9272912, 9326655, 9353145, 9421482, 9427713, 9454752, 9472655, 9472657, 9501224, 9547340, 9733846, 9878112, 9920850, 9929359	★☆☆☆☆ Found in Text Mining only
HIV Infections	Inhibit	10403921, 11069080, 11390619, 11800643, 12097565, 12121440, 12738771, 1402655, 15297312, 16632604, 1696859, 1700829, 17511038, 18974880, 19076827, 19912576, 19956090, 20208540, 20498045, 20520721, 21653240, 21859712, 21943198, 22134167, 22162758, 22310831, 22371879, 22726303, 24098454, 24348678, 24886575, 24985081, 25137293, 25423108, 26730570, 27281059, 27881646, 28125732, 28241075, 29563914, 30682089, 31043532, 31208015, 32098821, 32567004, 32591400, 32711474, 33093334, 34608862, 34753817, 37697423, 39230302, 7554447, 7586671, 7586672, 8450057, 9605996, 9787145	★☆☆☆☆ Found in Text Mining only
HIV Infections	Stimulate	11095734, 1373086, 22671952, 26671450, 32508833, 9714415	★☆☆☆☆ Found in Text Mining only
HIV Seropositivity	Associate	1351431, 19703245, 20715931, 30157919	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Associate	12116341, 16757686, 17158640, 17644739, 18362907, 18502823, 26084540, 2675617, 27312067, 2965930, 29880615, 32589698, 34506624, 34615710, 35111387, 37933048, 7518195, 7573367	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Stimulate	18956470	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Inhibit	34584203	★☆☆☆☆ Found in Text Mining only
HTLV I Infections	Inhibit	10102648, 14557656, 25081935, 31190065	★☆☆☆☆ Found in Text Mining only
HTLV I Infections	Associate	10447738, 11435401, 11698284, 11886260, 12805437, 12970439, 1438212, 14990729, 15367641, 15857992, 16425996, 1702159, 17320923, 17483473, 17609262, 17942534, 17956580, 18077723, 18596085, 1885736, 19300495, 19457989, 19570853, 19587052, 19663693, 19913863, 19917610, 19949656, 2144349, 23284797, 24517971, 2479771, 25148903, 2541442, 26358743, 26683952, 27434587, 27875993, 31142734, 33837058, 36214569, 7860769, 7884855, 8095306, 8516299, 8556497, 8807058, 8892896, 9499799, 9729533, 9733871, 9765450	★☆☆☆☆ Found in Text Mining only
HTLV II Infections	Associate	17035326	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Stimulate	34802797	★☆☆☆☆ Found in Text Mining only
Hyper IgM Immunodeficiency Syndrome	Associate	15086393	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Associate	10886202, 11298328, 11559946, 16219537, 19608752, 23642304, 25398061, 25682606, 32849632, 39788434, 8608231, 8642249	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Associate	17526997	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Stimulate	25894202	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Inhibit	30983877	★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Associate	27902892	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Associate	24116927, 29105795, 9824577	★☆☆☆☆ Found in Text Mining only
Hypersensitivity	Associate	11511310, 37074725	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Associate	1373352	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Associate	27764137	★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	27765883, 29388859, 33196557, 35586668	★☆☆☆☆ Found in Text Mining only
Hypertension Portal	Associate	34930041	★☆☆☆☆ Found in Text Mining only
Hypertension Pregnancy Induced	Inhibit	12623476, 29846432	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Associate	20973920, 31141166, 37731513	★☆☆☆☆ Found in Text Mining only
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	24774748, 26005050	★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets Autosomal Dominant	Associate	9389727	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Stimulate	40155866	★☆☆☆☆ Found in Text Mining only
Hypotrichosis	Associate	16489183	★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	10539886, 10880747, 34194423	★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	24931519	★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Stimulate	24931519, 37910505	★☆☆☆☆ Found in Text Mining only
Idiopathic Noncirrhotic Portal Hypertension	Associate	34930041	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Stimulate	10337028	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Associate	20126467, 22037258, 23262513, 28754682, 31694639, 32320626, 33386384, 36871016, 37266442, 37544465, 39205185, 39289672, 39510135	★☆☆☆☆ Found in Text Mining only
Idiopathic subglottic tracheal stenosis	Stimulate	32557663	★☆☆☆☆ Found in Text Mining only
IgA Vasculitis	Associate	10728756, 12699431, 13130466, 15661933, 18635598, 20929536, 23494522, 24022618, 26491701, 27769184, 2964958, 2972426, 34517873, 39924084, 7763112	★☆☆☆☆ Found in Text Mining only
Ige Responsiveness Atopic	Associate	24589341	★☆☆☆☆ Found in Text Mining only
Immune Dysregulation Polyendocrinopathy Enteropathy X Linked Syndrome	Associate	14597756, 16990602, 18489537, 19155519	★☆☆☆☆ Found in Text Mining only
Immune Reconstitution Inflammatory Syndrome	Associate	20660788, 22431997, 26611774, 29538651, 30728405, 31190065	★☆☆☆☆ Found in Text Mining only
Immune Reconstitution Inflammatory Syndrome	Stimulate	25492918	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Associate	12942579, 1373086, 1683740, 19923460, 21257970, 22837194, 23152910, 28940416, 31545490, 33193371, 34938286, 35618845, 35935994	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Inhibit	20196868, 30996137, 31398453, 36380676	★☆☆☆☆ Found in Text Mining only
Immunoblastic Lymphadenopathy	Associate	11337383, 3046680, 7902143	★☆☆☆☆ Found in Text Mining only
Immunoglobulin a deficiency 1	Stimulate	3289139	★☆☆☆☆ Found in Text Mining only
Immunoglobulin G4 Related Disease	Associate	27358392, 29434340, 29499100, 31856905, 36609529, 36831337, 37561593, 37762039, 38077321	★☆☆☆☆ Found in Text Mining only
Immunoglobulin G4 Related Disease	Stimulate	29039547	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Associate	11678896, 1380169, 20470401, 23658782, 25329064, 2564677, 27525551, 27902892, 31189571, 33073673, 33256375, 35163318, 35237272, 39735996, 9826720	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Inhibit	38112969	★☆☆☆☆ Found in Text Mining only
Indifference to Pain Congenital Autosomal Recessive	Associate	40241002	★☆☆☆☆ Found in Text Mining only
Infections	Associate	10559349, 10749578, 10864687, 11119612, 11287575, 11312658, 11696593, 11861835, 11902332, 12072498, 12374807, 12504566, 12552096, 12781713, 12857927, 14568977, 14632751, 15173593, 15194768, 15618192, 15650227, 15879023, 15890908, 15916792, 16393985, 16792668, 16928758, 17005693, 1702842, 17158230, 17312174, 17362263, 17507486, 17670831, 17889354, 17942534, 18178833, 18508887, 18798835, 18827929, 19019953, 19129457, 19165342, 19178925, 1931229, 19447460, 19535453, 19557157, 19698128, 19781520, 19838123, 20001317, 20147895, 20186035, 20222966, 21068257, 21628534, 21642597, 21828275, 21992606, 22166560, 2243398, 22615999, 22719887, 22740584, 2293663, 23029309, 23138836, 23209780, 23264589, 23365642, 23721325, 23791644, 24116927, 24837770, 25008921, 25423108, 25555152, 25797607, 26020637, 26275199, 26539983, 26559763, 26671450, 27466424, 28122636, 28148784, 28199704, 28892135, 28956765, 29118121, 29167762, 29287991, 29511683, 29661652, 30415390, 30477583, 30768357, 30842324, 30870532, 31127857, 31826842, 31857499, 32198428, 32348459, 32598880, 32762760, 32873094, 32886726, 33031103, 33166790, 33399535, 33835029, 34343169, 34346755, 34571855, 34616406, 34753817, 34882759, 34931886, 35011632, 35090598, 35112366, 35165387, 35215762, 35744023, 36229577, 36536105, 37030290, 37225706, 37408049, 37655880, 40284913, 7558138, 7699322, 7769729, 8094041, 8411372, 8461467, 8630388, 8995671, 9151834, 9218830, 9378492	★☆☆☆☆ Found in Text Mining only
Infections	Inhibit	16935861, 1871120, 1991165, 2144349, 24156513, 26730570, 27124899, 28591184, 34399785, 3548405, 36560637, 7474110, 9242540, 9787145	★☆☆☆☆ Found in Text Mining only
Infections	Stimulate	23822699, 30559208, 37161335	★☆☆☆☆ Found in Text Mining only
Infectious Mononucleosis	Associate	12594286, 1672270, 23569328, 2527653, 34882759, 8329707, 9158095	★☆☆☆☆ Found in Text Mining only
Inferior Wall Myocardial Infarction	Associate	24969587	★☆☆☆☆ Found in Text Mining only
Infertility	Associate	36603467	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	10596698, 10691908, 11050177, 11510804, 11511310, 14997933, 15128911, 15148216, 15661933, 15743472, 16782037, 16792668, 17483473, 17635814, 17828272, 17975675, 1831490, 18550855, 18684844, 19152963, 19208087, 19283780, 19480659, 19734235, 19904767, 20840654, 21397857, 21448265, 21606346, 21739422, 21917308, 22147555, 22157983, 22307621, 22313962, 22539948, 22633193, 22711477, 22965858, 23305119, 23818545, 24121758, 24136005, 24313359, 24338253, 24368924, 24391521, 24395888, 24441329, 24585897, 24641294, 24959711, 24960164, 25004830, 25198707, 25269704, 25309050, 25341640, 25375131, 25451162, 25484131, 25797206, 25824483, 25827621, 25884400, 25978359, 26385705, 26387944, 27124305, 27183178, 27377073, 27468819, 27708065, 27821506, 28241075, 28426727, 28453768, 28485799, 28502089, 28640942, 29066026, 29725326, 30218032, 30231065, 30232328, 30329194, 30389786, 30402903, 30537802, 30700717, 30759186, 30894863, 31145102, 31145753, 31440043, 31653682, 31909418, 32111105, 32300208, 32423044, 32532832, 32639582, 32647892, 32744608, 32766167, 32914944, 32974219, 32977850, 33196557, 33296081, 33298584, 33402994, 33426088, 33482899, 33552054, 33601057, 33717140, 33817728, 33902571, 34108969, 34113337, 34289887, 34589088, 34737186, 34755133, 34895167, 35015822, 35029177, 35219585, 35364330, 35385700, 35398299, 35485359, 35663467, 35805941, 35980979, 36180106, 36462403, 36499121, 36945068, 37088297, 37106402, 37225706, 37256725, 37373554, 37586415, 37600767, 37620910, 37809066, 37856221, 37918715, 37952293, 38009648, 38043109, 38207130, 38211712, 38412094, 39226901, 39769168, 40190436, 7500031, 8025072, 8113687, 9738953	★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	26962942, 28387597, 36505477	★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	30123214, 31316519	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	11298349, 15020649, 18330941, 18422560, 21147109, 21376048, 22158873, 22965858, 25978359, 28164626, 29547621, 31417161, 32016358, 32547537, 32598439, 34108969, 34224909, 34673799, 36167345, 36437465, 36746519, 37063924, 37124046, 37600767, 37752523, 39343250, 39586377, 9422543	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Stimulate	27001939	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Neoplasms	Associate	31145753, 35705026	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Neoplasms	Inhibit	33267869	★☆☆☆☆ Found in Text Mining only
Influenza Human	Associate	10954576, 15196256, 18781564, 21353149, 22314361, 22554464, 22715399, 26094691, 26489873, 27402904, 27571776, 29800425, 30692574, 33310880, 33976217, 34343169, 34795301, 35670811	★☆☆☆☆ Found in Text Mining only
Influenza Human	Stimulate	27821506, 30573748, 30619245	★☆☆☆☆ Found in Text Mining only
Insulin Like Growth Factor I Deficiency	Associate	25890304	★☆☆☆☆ Found in Text Mining only
Internal Hernia	Associate	38003629	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Associate	34858418, 36193061	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Inhibit	22228968	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Associate	28854225	★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Associate	36825028	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Associate	35833148	★☆☆☆☆ Found in Text Mining only
Invasive Pneumococcal Disease Recurrent Isolated 2	Associate	1440463, 34389623	★☆☆☆☆ Found in Text Mining only
Invasive Pulmonary Aspergillosis	Associate	24747947	★☆☆☆☆ Found in Text Mining only
Iris hypoplasia and glaucoma	Associate	34508765	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Associate	37648784	★☆☆☆☆ Found in Text Mining only
Job Syndrome	Associate	12067309, 22118528, 37916874	★☆☆☆☆ Found in Text Mining only
Kartagener Syndrome	Associate	31533488	★☆☆☆☆ Found in Text Mining only
Keratitis Herpetic	Associate	11069987	★☆☆☆☆ Found in Text Mining only
Keratoacanthoma	Stimulate	29799076	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	20977632, 26603521, 27413076, 31535918, 34531868	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Associate	11737371, 24189710, 25484131, 27460884, 27957330, 28858434	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Associate	31855296, 34030645, 37657842	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Stimulate	27180957	★☆☆☆☆ Found in Text Mining only
Laryngotracheal Stenosis Progressive with Short Stature and Arthropathy	Stimulate	32557663	★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Associate	26839444, 28396876	★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Inhibit	27357431	★☆☆☆☆ Found in Text Mining only
Latent Tuberculosis	Associate	25520147	★☆☆☆☆ Found in Text Mining only
Lead Poisoning Nervous System	Associate	10998137	★☆☆☆☆ Found in Text Mining only
Legg Calve Perthes Disease	Inhibit	38139422	★☆☆☆☆ Found in Text Mining only
Leishmaniasis	Associate	25139022	★☆☆☆☆ Found in Text Mining only
Leishmaniasis Cutaneous	Associate	25139022, 33793565	★☆☆☆☆ Found in Text Mining only
Leishmaniasis Visceral	Associate	25200768, 35106507, 38416647	★☆☆☆☆ Found in Text Mining only
Leprosy	Associate	16339528, 18424702, 22002092, 22205964, 23936569, 24214631, 25672298, 7524076	★☆☆☆☆ Found in Text Mining only
Leprosy	Stimulate	19618084	★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Associate	24214631, 24454972, 30642265	★☆☆☆☆ Found in Text Mining only
Leprosy Multibacillary	Associate	9822276	★☆☆☆☆ Found in Text Mining only
Leprosy Tuberculoid	Inhibit	22002092	★☆☆☆☆ Found in Text Mining only
Leprosy Tuberculoid	Associate	25470342, 3257577	★☆☆☆☆ Found in Text Mining only
Leptospirosis	Associate	26491036	★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	10458772, 10845931, 12393705, 15070688, 15295005, 15845894, 15958635, 16569594, 16585953, 18227839, 18316730, 20113470, 2070082, 20820776, 21205081, 21310823, 2195543, 22647666, 22753942, 2296082, 24741612, 25629163, 25815345, 26474588, 2783859, 2846089, 29805109, 30619360, 32812702, 35210405, 35255120, 35820057, 36010641, 36179686, 8611704, 8652829, 8896419, 8995603, 9485189, 9716596	★☆☆☆☆ Found in Text Mining only
Leukemia	Stimulate	20801903	★☆☆☆☆ Found in Text Mining only
Leukemia Acute X Linked	Associate	22875869	★☆☆☆☆ Found in Text Mining only
Leukemia B Cell	Associate	10864684, 32174910, 33421548	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Associate	20687201, 23347903, 7911341	★☆☆☆☆ Found in Text Mining only
Leukemia Large Granular Lymphocytic	Associate	12139733, 12875995, 17303697, 18768393, 19251297, 20448385, 2302461, 28441377, 31866622, 35210405, 8822933	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	10068672, 10419899, 11678896, 11981828, 12393705, 14615377, 15536147, 15965501, 1680497, 17019687, 19895614, 20081380, 20562332, 21455998, 21523729, 21904560, 22101351, 22842611, 23300177, 23807677, 24166938, 25286418, 26140546, 26478573, 27369070, 27927767, 29276179, 29925389, 30336122, 32581054, 33421548, 35193595, 35511436, 36826109, 37824808, 7909242, 9074413, 9596676, 9766799	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Inhibit	12780786, 15138491, 2459562	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoma Adult T Cell	Associate	10845931, 11838588, 1373087, 15009733, 16108835, 16585963, 20222966, 21205081, 21300980, 22647666, 24041428, 24363428, 25519886, 26552867, 26683952, 29444188, 30518541, 31642546, 35315593, 36851682, 36997002, 8390425, 9233579	★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	10419896, 18316730, 19706888, 20470401, 21269567, 28049640, 29805109, 29925907	★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Inhibit	9259585	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Associate	15958635, 17005036, 19903675, 28807569	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	12010820, 12483012, 15388576, 22592607, 22879624, 24741612, 24757092, 24961348, 25400771, 27821506, 2783859, 29843224, 29908544, 29922294, 32456622, 33054115, 33957373, 34011073, 34555853, 34845035, 34913594, 35820057, 35924580, 36081495, 36477735, 36960073, 37288810, 37759316, 7579404, 9002966, 9920842	★☆☆☆☆ Found in Text Mining only
Leukemia Plasma Cell	Associate	24715427	★☆☆☆☆ Found in Text Mining only
Leukemia Prolymphocytic	Associate	1680497	★☆☆☆☆ Found in Text Mining only
Leukemia Prolymphocytic	Inhibit	1742486	★☆☆☆☆ Found in Text Mining only
Leukemia Prolymphocytic T Cell	Associate	10403909, 11122109, 21463298, 21985361, 31412798, 3486061	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Associate	8095167	★☆☆☆☆ Found in Text Mining only
Leukemia T Cell	Associate	14984494, 16371020, 17891925, 18417567, 19734979, 23025755, 23759068, 8100486	★☆☆☆☆ Found in Text Mining only
Leukemia T Cell	Inhibit	27565576	★☆☆☆☆ Found in Text Mining only
Leukemic Infiltration	Associate	39201715	★☆☆☆☆ Found in Text Mining only
Leukoencephalopathies	Associate	36796230	★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy Progressive Multifocal	Associate	22549384	★☆☆☆☆ Found in Text Mining only
Leukopenia	Associate	35586668	★☆☆☆☆ Found in Text Mining only
Lichen Planus	Associate	1430362	★☆☆☆☆ Found in Text Mining only
Lichen Planus Oral	Associate	18782324, 26594049, 27383402, 30329194, 31792433, 33544810, 34670484, 36397025, 37808434, 39369184	★☆☆☆☆ Found in Text Mining only
Lichen Sclerosus et Atrophicus	Associate	11891200	★☆☆☆☆ Found in Text Mining only
Lichenoid Eruptions	Associate	36397025	★☆☆☆☆ Found in Text Mining only
Limbic Encephalitis	Associate	34841709	★☆☆☆☆ Found in Text Mining only
Linitis Plastica	Associate	36703611	★☆☆☆☆ Found in Text Mining only
Lipedema	Associate	37108757	★☆☆☆☆ Found in Text Mining only
Liposarcoma	Associate	34465597	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Associate	23840511, 30740944	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Associate	20638239, 21735469, 23681290, 24116927, 25042122, 25627620, 27631617, 28425483, 30600293, 35309298, 7851017, 9545531	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Associate	15634930, 25953611, 29281718, 33386815	★☆☆☆☆ Found in Text Mining only
Liver Failure	Associate	36635631, 37327339	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Associate	16937439, 29229400	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Inhibit	21605420	★☆☆☆☆ Found in Text Mining only
Loeys Dietz Syndrome	Associate	23884466	★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Associate	30644704	★☆☆☆☆ Found in Text Mining only
Lown Ganong Levine Syndrome	Stimulate	33475152	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Associate	15730402, 18241227, 24116927, 34867961, 35364330, 7586671	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Inhibit	40190436	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Associate	12827664, 16287509, 22288596, 27145754, 29172719, 32162841, 33298584, 33413573, 35250976, 37535195, 37898737	★☆☆☆☆ Found in Text Mining only
Lung Injury	Stimulate	27230446	★☆☆☆☆ Found in Text Mining only
Lung Injury	Associate	32801053	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	11970966, 16585607, 18064389, 20565977, 21681373, 24244422, 24761885, 25325779, 27692344, 28253320, 31043415, 31066485, 33859531, 34048945, 34137173, 36219677, 37580655, 38007577, 40157887	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Inhibit	28187172	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Associate	17530636, 32082077	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Stimulate	35979531	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	10430616, 10508246, 11315925, 11352243, 12568118, 14872508, 15004168, 15147571, 15476242, 15498047, 15547095, 16606650, 16802356, 16879242, 17277168, 17665008, 17947713, 18194272, 18311820, 18451510, 18505426, 18505436, 18576316, 18641361, 18668553, 18800986, 19155519, 19289577, 19520616, 19815495, 19841178, 19843090, 20131288, 20506525, 20589076, 20625494, 21110900, 21192791, 21436623, 21538319, 21708033, 21959034, 22235999, 22549474, 22549634, 22621248, 22835828, 23019580, 23434382, 23623029, 23913957, 23915345, 23950730, 23962407, 24047902, 24082908, 24391825, 24463447, 24495300, 24500400, 25070893, 25454068, 26005050, 26055806, 26079624, 26209442, 26453305, 26582197, 26764034, 27065298, 27111767, 27156107, 27424138, 27600584, 27737517, 27852285, 27915349, 28430662, 28793932, 28973837, 29018507, 29066026, 30009168, 30315781, 30662367, 30962246, 31331400, 31354747, 31412880, 31431691, 31514450, 31536480, 31653682, 31781109, 31808546, 31848026, 33007439, 33176801, 33329581, 33562078, 33670902, 33882880, 34079550, 34149710, 34256772, 34890161, 34899718, 34940981, 35172900, 35762881, 35940821, 36075396, 36180106, 36314527, 36351407, 36499016, 36536372, 36703979, 36748375, 36781170, 36815949, 37072752, 37114204, 37179450, 37400575, 37586763, 38078808, 39333474, 39375179, 39388354, 7531628, 8403494, 9716112	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Inhibit	14871297, 16423064, 19173720, 26076826, 30988119, 32718891, 35130317, 8100746, 8918566	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Stimulate	20334681, 24774748, 32317002, 33475152	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Associate	12568118, 16879242, 19021013, 20213807, 21635228, 24475019, 24774748, 27156107, 31331400, 31536480, 31685786, 33277543, 34081342, 36430418	★☆☆☆☆ Found in Text Mining only
Lupus Vasculitis Central Nervous System	Associate	14764530	★☆☆☆☆ Found in Text Mining only
Lyme Disease	Associate	11005833, 23450683, 37471146	★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Associate	26763360	★☆☆☆☆ Found in Text Mining only
Lymphangiectasis Intestinal	Associate	38022535	★☆☆☆☆ Found in Text Mining only
Lymphangiectasis Intestinal	Inhibit	9862365	★☆☆☆☆ Found in Text Mining only
Lymphatic Abnormalities	Associate	38022535	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	23826668, 24870595, 36980192, 37270478, 38263363	★☆☆☆☆ Found in Text Mining only
Lymphedema	Stimulate	37108757	★☆☆☆☆ Found in Text Mining only
Lymphocytic Choriomeningitis	Associate	21900169	★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Stimulate	10908151, 31310589	★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Associate	12875995, 17303697, 28441377, 7890378	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Associate	27925643, 37401643	★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	10803703, 12095642, 14592815, 16410445, 17388670, 17615291, 17891925, 18227839, 19443664, 20176801, 21274672, 21904560, 22647666, 23025755, 25628470, 26464657, 27193732, 27980301, 28885361, 2943330, 30237271, 3120822, 33202420, 35895386, 7678256	★☆☆☆☆ Found in Text Mining only
Lymphoma AIDS Related	Associate	39324141	★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Associate	10540330, 19443664, 19509224, 21463298, 21538319, 21854084, 22174855, 25568348, 25595783, 26464657, 28732145	★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Stimulate	26084540	★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell Marginal Zone	Associate	27306341, 32963045	★☆☆☆☆ Found in Text Mining only
Lymphoma Extranodal NK T Cell	Associate	26497849	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Associate	10540330, 18814264, 21270444, 22015774, 23775959, 25700246, 29293620, 30784598, 33133070, 34267181, 35030632, 35687817, 39248131	★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	23670212, 24833097, 27709793, 28192480, 28537908, 32079690, 34422089, 35983077, 37234150, 37801226, 38099311, 38531803, 39665214	★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Inhibit	26355571, 35401516	★☆☆☆☆ Found in Text Mining only
Lymphoma Large Cell Anaplastic	Associate	10886202, 30206415, 9347791	★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	10540330, 17615291, 19606255, 23302373, 26084540, 27605551, 30659053, 34539622, 35789341, 36649311, 36826995	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	23368872	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Effusion	Associate	18166773, 22234686, 27893813	★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell	Associate	10861691, 1380169, 16219537, 18311111, 1831409, 21079332, 2118401, 21881587, 24499954, 2546634, 25619965, 26268241, 27105079, 27312067, 2943330, 29517683, 31645398, 35523507, 36325319	★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell Cutaneous	Associate	10433941, 10886511, 10910922, 11121132, 11564173, 12200382, 15514008, 15816832, 17340017, 17401465, 18684941, 19505389, 19626037, 20107729, 20713771, 21191411, 24151865, 24523507, 2527911, 27929746, 28625481, 29895574, 32760603, 34220814, 34608214, 35947128, 38326614, 7706773, 8721488, 9596682, 9717967	★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell Cutaneous	Stimulate	10504451	★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell Peripheral	Associate	23037630, 24618604, 2469701, 27312067, 27861791, 34980830, 36544095, 37933048, 9488618	★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Associate	9347791	★☆☆☆☆ Found in Text Mining only
Lymphopenia	Associate	10606975, 11737070, 12121441, 12204949, 16038781, 17034579, 18456875, 21209878, 21257970, 21494598, 22476911, 25205547, 25604093, 26246517, 31639143, 31714901, 32217834, 33228556, 33362779, 33912168, 35316209, 36174772, 36197228, 37408049, 38139422, 38441205, 39224595, 8609222, 9008288, 9664084	★☆☆☆☆ Found in Text Mining only
Lymphopenia	Inhibit	31781092, 32427393, 37279717, 37848421	★☆☆☆☆ Found in Text Mining only
Lymphopenic Hypergammaglobulinemia Antibody Deficiency Autoimmune Hemolytic Anemia and Glomerulonephritis	Associate	10403927, 17935071, 26459150, 27821506	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Associate	10864684, 11509608, 12437636, 15691277, 29517683, 31558678, 33965183, 35523507	★☆☆☆☆ Found in Text Mining only
Lysosomal Storage Diseases	Associate	24463447	★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Associate	25467409, 25797607	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Associate	28377586, 29132135, 39547643	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Stimulate	35352887	★☆☆☆☆ Found in Text Mining only
Malaria	Associate	19877016, 25646355, 26173100, 32983106	★☆☆☆☆ Found in Text Mining only
Malaria Falciparum	Inhibit	23295747	★☆☆☆☆ Found in Text Mining only
Malnutrition	Associate	17362263	★☆☆☆☆ Found in Text Mining only
Malocclusion Angle Class II	Associate	30644704	★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Associate	22479353	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Associate	32174910, 36759849	★☆☆☆☆ Found in Text Mining only
Measles	Associate	22532682, 27251754	★☆☆☆☆ Found in Text Mining only
Megalencephalic leukoencephalopathy with subcortical cysts	Associate	32508833	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	10049939, 10049951, 10330445, 10618430, 10684854, 11259659, 11742496, 12794170, 14770079, 15085202, 16799335, 1712819, 18343923, 18414854, 18606658, 18941742, 19435913, 19581576, 19651643, 19779716, 20547105, 20696919, 21397857, 21690475, 21903207, 22371843, 22400038, 22454499, 23935194, 24396833, 24756419, 26245876, 26608910, 26641258, 27094152, 28640942, 29360643, 29895674, 30123214, 31275310, 31630873, 32210968, 32246006, 33031392, 33785258, 33820810, 34220837, 35189004, 35383113, 35508657, 37418389, 37466381, 37466668, 37505479, 39210005, 40226614, 7923247, 8101473, 9182821	★☆☆☆☆ Found in Text Mining only
Melanoma	Inhibit	29546435, 37170241	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Associate	34047683, 34531868	★☆☆☆☆ Found in Text Mining only
MELAS Syndrome	Associate	38499449	★☆☆☆☆ Found in Text Mining only
Melorheostosis	Inhibit	34187516	★☆☆☆☆ Found in Text Mining only
Meningioma	Associate	25400783, 40441235	★☆☆☆☆ Found in Text Mining only
Meningioma	Inhibit	25609200	★☆☆☆☆ Found in Text Mining only
Meningitis Cryptococcal	Associate	23493728	★☆☆☆☆ Found in Text Mining only
Meningitis Fungal	Inhibit	36946852	★☆☆☆☆ Found in Text Mining only
Mental Retardation X Linked 94	Associate	20735940	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Associate	30245692	★☆☆☆☆ Found in Text Mining only
Metabolic Side Effects of Drugs and Substances	Associate	9151834	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Associate	36865544	★☆☆☆☆ Found in Text Mining only
Methylmalonic Aciduria due to Methylmalonyl CoA Mutase Deficiency	Inhibit	27799384	★☆☆☆☆ Found in Text Mining only
Microsatellite Instability	Associate	30894409	★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Associate	39672520	★☆☆☆☆ Found in Text Mining only
Milk Hypersensitivity	Associate	12138061	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Associate	11739707, 30320604, 31707363, 36462403	★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Stimulate	16150935	★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Associate	21904560	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Inhibit	18276105	★☆☆☆☆ Found in Text Mining only
Motor Disorders	Associate	23054369	★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Associate	11439170	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Associate	12412747, 25275597, 28193831, 32063460, 33007050	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Associate	36086675	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Associate	28754092, 29168181, 32744608	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Associate	31532776	★☆☆☆☆ Found in Text Mining only
Mpox (monkeypox)	Inhibit	36356606	★☆☆☆☆ Found in Text Mining only
Mucinoses	Associate	38013542	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Associate	12653853, 18070150, 22645426, 33188570, 33622252, 35222381, 35755167, 35924269, 7851022, 9486410, 9790317	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Inhibit	38357816	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Associate	33514545	★☆☆☆☆ Found in Text Mining only
Mucor infection	Associate	36305225	★☆☆☆☆ Found in Text Mining only
Mucositis	Associate	22156200, 29511683, 34589088	★☆☆☆☆ Found in Text Mining only
Mulibrey Nanism	Associate	33042106	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	14717778, 15578069, 16150935, 16410445, 18071334, 18156498, 1832993, 20568250, 20651070, 21030562, 21904560, 22666318, 23152910, 23232072, 25099367, 29511683, 33488620, 34502204, 35222688, 36105747, 36982802, 37815499, 38574299, 39175948, 8605346, 9504626, 9504628	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Inhibit	15750834, 33013907	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	10193428, 10736102, 11602626, 15048733, 16547138, 17897326, 18156204, 18378324, 18727631, 18769633, 19016907, 19740340, 19740385, 20065129, 20148420, 20174631, 20661655, 21067621, 21079332, 21281812, 21300823, 21427490, 21653833, 21810280, 22182694, 22768094, 22837658, 23039885, 23202893, 23638056, 24282598, 24376757, 24453076, 24659064, 24852325, 25738751, 25938517, 26203907, 26829210, 26849221, 27162345, 27424664, 27438997, 27570566, 27626663, 28155899, 28301515, 28729889, 29168181, 29290406, 30173916, 30305453, 30379917, 30698680, 30759186, 30848579, 31024521, 31427643, 31566584, 31581595, 31968593, 32328067, 32375811, 32518073, 32817525, 33037101, 33091337, 33112414, 33158438, 33222687, 33354282, 33529846, 34006899, 34251726, 34285924, 34561436, 34643957, 34873174, 35266286, 35479072, 35672799, 35693770, 35868128, 36341423, 37106402, 37506490, 37824079, 38009648, 8197142, 8901604, 9119974	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Inhibit	29295981	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Associate	30770703	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Relapsing Remitting	Associate	16412055, 17897326, 20148420, 24901013, 25261476, 26095162, 28729889, 28766461, 31167379, 31180553, 33354282, 33529846, 35022272, 35328606	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Relapsing Remitting	Stimulate	23611040	★☆☆☆☆ Found in Text Mining only
Muscle Neoplasms	Associate	19692168, 36194662	★☆☆☆☆ Found in Text Mining only
Muscular Atrophy	Inhibit	30977974	★☆☆☆☆ Found in Text Mining only
Muscular dystrophy congenital with central nervous system involvement	Associate	10331508	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Associate	20382434	★☆☆☆☆ Found in Text Mining only
Myalgia	Associate	32896291	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Associate	10525041, 11785677, 14575152, 15049785, 15454488, 16585608, 17323412, 23110942, 26347149, 32243615, 33136553, 35265719, 35979348, 38325197, 40525756, 8094093, 8827715, 9737677, 9867130	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis Autoimmune Experimental	Associate	15454488, 17323412	★☆☆☆☆ Found in Text Mining only
Mycobacterium avium intracellulare Infection	Associate	9657559	★☆☆☆☆ Found in Text Mining only
Mycobacterium Infections	Associate	33296702	★☆☆☆☆ Found in Text Mining only
Mycobacterium Infections Nontuberculous	Associate	10779786, 11211316, 15273814	★☆☆☆☆ Found in Text Mining only
Mycoses	Associate	30644704	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Associate	10504456, 1828937, 1987296, 19935642, 21148332, 22722467, 25044837, 25158034, 2527911, 28206666, 28441377, 30770361, 35406628, 35642346, 36428999	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Stimulate	38013542	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Associate	12358908, 12404285, 20647647, 21097671, 23453286, 33570632, 34631897	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Inhibit	27036031, 31705171	★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorder Chronic with Eosinophilia	Associate	30816121	★☆☆☆☆ Found in Text Mining only
Myeloproliferative Syndrome Transient	Associate	11966768	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	19394279, 19843577, 22426168, 23330016, 24453425, 26375412, 28260995, 34857156, 37798364, 40685440	★☆☆☆☆ Found in Text Mining only
Myocarditis	Associate	28018858, 37382257	★☆☆☆☆ Found in Text Mining only
Myopathies Structural Congenital	Associate	25141905	★☆☆☆☆ Found in Text Mining only
Myositis	Associate	27936488, 35371068, 39946176, 9008283	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Associate	24594700, 35131904	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Inhibit	26095067, 33287713	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Associate	34830017, 35727147	★☆☆☆☆ Found in Text Mining only
Mysophobia	Associate	22031506, 25225461, 28241075	★☆☆☆☆ Found in Text Mining only
Narcolepsy	Associate	17665008, 27821550, 33837283	★☆☆☆☆ Found in Text Mining only
Narcolepsy 1	Associate	28107375, 31048269, 37380713	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Associate	19250527, 20515572, 25269704, 26239551, 27468819, 36466903	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Stimulate	19639723	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	14694109, 17262084, 18297191, 19220831, 22226739, 31574860	★☆☆☆☆ Found in Text Mining only
Necrosis	Associate	11967324, 18596085	★☆☆☆☆ Found in Text Mining only
Neonatal herpes	Associate	28007920	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	12045238, 25119597, 26317902, 27110571, 27323163, 28210081, 28841418, 29390966, 29757775, 29774030, 33308232, 34229299, 34808386, 35189004, 35296750, 35383113, 36980192, 37261085, 38062230, 39838423	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	24519063	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	28038471, 36915210	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	10049939, 10049951, 10233901, 10330445, 10361224, 10540330, 10682684, 10864684, 10886511, 10944605, 11337383, 11342451, 11466395, 11564173, 11591807, 11742496, 11862476, 12010820, 12021307, 12045238, 12208877, 12357321, 12483012, 12536238, 12538712, 12682787, 12794170, 12853579, 12942579, 1353365, 14583468, 14611679, 14612896, 14635058, 14738463, 14738769, 14770079, 14968119, 1501285, 15085202, 15197261, 15388576, 15600300, 15618192, 15790789, 15832009, 1631166, 16362412, 16367922, 16489049, 16723631, 16775224, 16778109, 16836768, 16947022, 16984392, 16998465, 17063124, 17068154, 17109473, 17183685, 17186289, 17235436, 17508019, 17724589, 17947658, 18004564, 18156498, 18221909, 1828937, 18307280, 18326821, 1836455, 18413766, 18414854, 18424733, 18606658, 18658027, 18751426, 18761663, 18818309, 18820132, 18923710, 18925324, 19238009, 19289577, 19380765, 19557412, 19581576, 19596912, 19685052, 19692168, 19707583, 19798410, 19812686, 19883432, 19917695, 2007247, 20179673, 20231613, 20460488, 20473949, 20547105, 20549821, 20661468, 20686664, 20696919, 20734397, 20857101, 21048114, 21059769, 21079332, 21200385, 21300980, 2137847, 2147109, 21569810, 21630107, 21681373, 21705450, 21825174, 21858191, 21903207, 21930068, 22187279, 22226739, 22234686, 22252752, 22252753, 22319577, 22371843, 22506556, 22507318, 22555974, 22585562, 22592607, 23025755, 23251433, 23302373, 23526963, 23603862, 23681603, 23836412, 23935194, 23958949, 23977174, 2398528, 24064667, 24110741, 24122851, 24127572, 24136748, 24244422, 24244610, 24396833, 24512329, 24691423, 24764581, 24812403, 24862743, 24894090, 24952243, 25445815, 25550807, 25593302, 25605488, 25611283, 25713363, 2574630, 25779340, 25791067, 25931171, 25993655, 26042612, 26081906, 26249178, 26280204, 26317902, 26460798, 26461054, 26516200, 26517519, 26578623, 26608910, 26617911, 26681737, 26719303, 26759006, 26822383, 26851185, 26862849, 26964534, 26993499, 27094152, 27121473, 27163739, 27191652, 27323163, 27324616, 27393506, 27401140, 27463005, 27491898, 27669423, 27727484, 27766406, 2783889, 2784355, 27887569, 27894751, 28061450, 28187172, 28210081, 28239749, 28377481, 28378637, 28388539, 28475007, 2851398, 28640942, 28642246, 28817603, 28880903, 28949934, 29066174, 29105795, 29122757, 29243049, 29269008, 29350470, 29351920, 29360643, 29400599, 29466768, 29478100, 29559470, 29757775, 29767245, 29805109, 30006485, 30042403, 30046006, 30069490, 30075702, 30075815, 30093453, 30123214, 30144808, 30219078, 30221739, 30259082, 30267840, 30282837, 30285662, 30382883, 30389786, 30483834, 30505306, 30562358, 30619360, 30659053, 30683863, 30718678, 30719701, 30925186, 30963401, 30977974, 30978241, 31006654, 31066485, 31145753, 31205958, 31229590, 31275310, 31340866, 31354723, 31481117, 31495665, 31549213, 31562978, 31567189, 31609157, 31624246, 31631566, 31660687, 31690954, 31729458, 31740786, 31874858, 31879171, 31921188, 32074080, 32082077, 32111794, 32124416, 32222891, 32246006, 32277125, 32433601, 32497499, 32505533, 32514618, 32571262, 32589698, 32591861, 32592066, 32681091, 32728225, 32738272, 32878426, 32937437, 33007050, 33087896, 33101776, 33125511, 33205061, 33262074, 33275172, 33301062, 33310773, 33332284, 33338852, 33408343, 33462898, 33497464, 33513276, 33536348, 33546043, 33570632, 33602930, 33619294, 33676448, 33711637, 33763071, 33784259, 33785258, 33796412, 33893830, 33914317, 33968044, 33981015, 34048945, 34074699, 34086741, 34089373, 34177901, 34191790, 34218652, 34220837, 34252356, 34266885, 34362334, 34365471, 34386013, 34397869, 34484468, 34510503, 34511484, 34534729, 34539667, 34598322, 34608214, 34626165, 34635074, 34654352, 34668039, 34707600, 34711663, 34717544, 34729929, 34769191, 34796980, 34808386, 34814296, 35039463, 35042311, 35051220, 35092558, 35111387, 35149709, 35187162, 35219893, 35243806, 35321516, 35358652, 35363173, 35371002, 35379963, 35383113, 35443723, 35456394, 35481289, 35484226, 35534879, 35535782, 35603183, 35630004, 35687817, 35794182, 35831288, 35855531, 35858620, 35868661, 35881197, 35907841, 35918384, 35940161, 35969754, 35973335, 35975176, 36040405, 36064338, 36070764, 36208136, 36219677, 36221095, 36224603, 36232369, 36275893, 36285482, 36302799, 36316038, 36319566, 36373309, 36434686, 36469096, 36505399, 36512410, 36518753, 36524209, 36536232, 36581331, 36593398, 36752300, 36814840, 36849756, 36864443, 36869048, 36871023, 36939254, 36969745, 36980192, 37000627, 37006050, 37033978, 37063862, 37090736, 37133586, 37150900, 37164914, 37170241, 37172580, 37199043, 37232845, 37313656, 37322820, 37338527, 37342362, 37349318, 37365518, 37373171, 37392167, 37453246, 37483596, 37491740, 37505479, 37523561, 37565053, 37582713, 37622107, 37648263, 37657842, 37711623, 37778272, 37899130, 37919068, 37920460, 37923822, 37928530, 37952080, 37970473, 38035072, 38057799, 38062068, 38073318, 38169538, 38244726, 38259671, 38415552, 38583239, 38594917, 39175022, 39201771, 39238637, 39264227, 39289669, 39327585, 39409156, 39508845, 39568014, 39684891, 39914494, 39955556, 39958339, 40069612, 40157887, 40183319, 40191190, 40205583, 40239399, 40243892, 40547009, 40655141, 7790320, 7909607, 7913843, 7961115, 8205556, 8331293, 8932341, 9378492, 9505825, 9566785, 9596676, 9596682, 9710220, 9731051	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	17122624, 17372588, 21638125, 23826668, 28488547, 31351430, 33095470, 36588538, 7909242	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	18163472, 24870595, 26927070, 27163739, 30670769, 32296437, 32761426, 34663810, 35705026, 37466381, 38077321, 40345896	★☆☆☆☆ Found in Text Mining only
Neoplasms Adipose Tissue	Associate	21801351, 33854130	★☆☆☆☆ Found in Text Mining only
Neoplasms Adipose Tissue	Stimulate	25388403	★☆☆☆☆ Found in Text Mining only
Neoplasms Cystic Mucinous and Serous	Associate	19641607	★☆☆☆☆ Found in Text Mining only
Neoplasms Glandular and Epithelial	Associate	10414503	★☆☆☆☆ Found in Text Mining only
Neoplasms Plasma Cell	Associate	23171203	★☆☆☆☆ Found in Text Mining only
Neoplasms Squamous Cell	Associate	12716470, 20110382, 23940084, 25779340, 31429521, 34529129	★☆☆☆☆ Found in Text Mining only
Neoplasms Unknown Primary	Associate	35074904	★☆☆☆☆ Found in Text Mining only
Nephritis	Associate	16879242, 24774748, 33882880	★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Associate	36384506	★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Associate	21762125, 26123900, 28963877	★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Associate	1803038	★☆☆☆☆ Found in Text Mining only
Nerve Degeneration	Associate	32744608	★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Associate	26329520	★☆☆☆☆ Found in Text Mining only
Netherton Syndrome	Associate	30477583	★☆☆☆☆ Found in Text Mining only
Neuhauser syndrome	Associate	28049640	★☆☆☆☆ Found in Text Mining only
Neuralgia Postherpetic	Associate	35720399	★☆☆☆☆ Found in Text Mining only
Neurobehavioral Manifestations	Inhibit	27244229	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	31141166, 32514618, 33252831, 33338852, 33968044, 34569303, 36923280, 8794385	★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Associate	28874213, 31107306	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Associate	25197660	★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors Primitive	Associate	26963506	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Associate	28475007	★☆☆☆☆ Found in Text Mining only
Neuroinflammatory Diseases	Associate	24282598	★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Associate	23202893	★☆☆☆☆ Found in Text Mining only
Neurosyphilis	Associate	29167762, 38174681	★☆☆☆☆ Found in Text Mining only
Neurotoxicity Syndromes	Inhibit	36097223	★☆☆☆☆ Found in Text Mining only
Neutropenia	Associate	10583274, 19344427, 31866622	★☆☆☆☆ Found in Text Mining only
Neutropenia and hyperlymphocytosis with large granular lymphocytes	Associate	11737000	★☆☆☆☆ Found in Text Mining only
Neutrophilia Hereditary	Inhibit	33613548	★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Associate	11427422	★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Inhibit	14632755	★☆☆☆☆ Found in Text Mining only
Non alcoholic Fatty Liver Disease	Associate	34552988, 34850389, 36865544, 37089050, 37373554	★☆☆☆☆ Found in Text Mining only
Non Muscle Invasive Bladder Neoplasms	Associate	35958598	★☆☆☆☆ Found in Text Mining only
Noncommunicable Diseases	Associate	34970271	★☆☆☆☆ Found in Text Mining only
Noninsulin dependent diabetes mellitus with deafness	Associate	38499449	★☆☆☆☆ Found in Text Mining only
Nose Diseases	Associate	19639723	★☆☆☆☆ Found in Text Mining only
Obesity	Stimulate	22044858, 22228716	★☆☆☆☆ Found in Text Mining only
Obesity	Associate	29956501, 33123595, 34231954, 34576307, 34721414, 34850389, 35111163, 36194662, 36945068, 37063877, 37878496, 38207130, 39765379, 39868576	★☆☆☆☆ Found in Text Mining only
Obesity Maternal	Stimulate	33912153	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Associate	37266430	★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Stimulate	25350973	★☆☆☆☆ Found in Text Mining only
Oncogene Addiction	Associate	21486722	★☆☆☆☆ Found in Text Mining only
Opportunistic Infections	Associate	11982603, 22398371, 26683952, 28299915, 31191551, 36840494, 8609222	★☆☆☆☆ Found in Text Mining only
Opportunistic Infections	Inhibit	37133586	★☆☆☆☆ Found in Text Mining only
Optic Nerve Diseases	Associate	40160813	★☆☆☆☆ Found in Text Mining only
Organizing Pneumonia	Associate	31653682	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Associate	21958417	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	10419780, 15731292, 20430731, 24742142, 27044824, 28112376, 29283192, 33482899, 34397812, 38401067, 39738612	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Stimulate	31205958	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Associate	37731506	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Associate	29283192	★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 1A	Associate	35711453	★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 3	Associate	34426754	★☆☆☆☆ Found in Text Mining only
Osteolysis	Associate	19214244	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Associate	32954739	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	24519063, 28671022, 37150900, 40374042	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Inhibit	37993664	★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Stimulate	22382400	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	19673890, 21829534, 22083345, 23354626, 23526963, 24244610, 24764581, 31064389, 31537619, 33381581, 33414414, 35940161, 36545327, 36604635, 36837407, 37063862, 37317670, 37446361, 37950246, 7648722, 8407555	★☆☆☆☆ Found in Text Mining only
Pagetoid Reticulosis	Associate	18342715	★☆☆☆☆ Found in Text Mining only
Pain	Associate	35720399	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	16947023, 19798410, 25827621, 31068935, 31796877, 34531868, 35012444, 36029726, 36509285, 37861515, 37881431	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Inhibit	37455016	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Associate	28705256, 30894427	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Associate	24797069, 34702715	★☆☆☆☆ Found in Text Mining only
Papilloma	Associate	19861144, 22322668, 28060843, 38193541	★☆☆☆☆ Found in Text Mining only
Papillomavirus Infections	Associate	23406965, 39690095, 7908483	★☆☆☆☆ Found in Text Mining only
Papillomavirus Infections	Inhibit	33007050	★☆☆☆☆ Found in Text Mining only
Paralysis	Associate	33178221	★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes Nervous System	Associate	32744608	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Associate	15864345, 15864353, 17409595, 17483473, 18190256, 18326816, 18664281, 19740339, 21208912, 22335964, 22647666, 23405908, 23409198, 24041428, 24845974, 24960164, 26358743, 31340370, 33837058, 39339919, 40004169	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Stimulate	8052162	★☆☆☆☆ Found in Text Mining only
Paraproteinemias	Associate	8605346	★☆☆☆☆ Found in Text Mining only
Paresthesia	Associate	19740340	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	19505389, 20813038, 23054369, 27230441, 32884248, 33272323, 33386815, 33514545, 34289265, 35279225, 36224715, 36499121, 36591658, 37454237, 39769168	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Inhibit	24933638	★☆☆☆☆ Found in Text Mining only
Paroxysmal nonkinesigenic dyskinesia	Associate	21912648	★☆☆☆☆ Found in Text Mining only
Pathological Conditions Anatomical	Associate	29992127	★☆☆☆☆ Found in Text Mining only
Peanut Hypersensitivity	Associate	29408715, 30304054, 31654649, 33658990	★☆☆☆☆ Found in Text Mining only
pediatric multisystem inflammatory disease COVID 19 related	Associate	34035116	★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Associate	30809229	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Associate	37266648	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Associate	15320912, 29335495	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Inhibit	22310732	★☆☆☆☆ Found in Text Mining only
Pemphigus	Associate	18373702, 24813052, 33741391, 36203615	★☆☆☆☆ Found in Text Mining only
Pemphigus and fogo selvagem	Associate	10642599, 35632621	★☆☆☆☆ Found in Text Mining only
Peri Implantitis	Associate	36267464	★☆☆☆☆ Found in Text Mining only
Periapical Diseases	Associate	39972438	★☆☆☆☆ Found in Text Mining only
Periodic fever familial autosomal dominant	Associate	17767733, 33176801	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Associate	12067311, 22066676, 7685315	★☆☆☆☆ Found in Text Mining only
Periodontitis	Associate	10632663, 26732676, 27334899, 30944162, 37063877, 8608641	★☆☆☆☆ Found in Text Mining only
Periodontitis	Stimulate	33109155	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Associate	40761788	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Associate	36671424	★☆☆☆☆ Found in Text Mining only
Periprosthetic Fractures	Associate	19214244	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Associate	33269456	★☆☆☆☆ Found in Text Mining only
Peritonitis	Associate	12942579	★☆☆☆☆ Found in Text Mining only
Peritonitis	Inhibit	16703796, 34360900	★☆☆☆☆ Found in Text Mining only
Persistent Infection	Associate	1678437, 19146663, 24298980	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Associate	34531868	★☆☆☆☆ Found in Text Mining only
Pituitary ACTH Hypersecretion	Associate	30722035	★☆☆☆☆ Found in Text Mining only
Plaque Atherosclerotic	Associate	15879154, 18832677, 19843577, 22282196, 34636650, 36077273	★☆☆☆☆ Found in Text Mining only
Plasma Cell Granuloma Pulmonary	Associate	24995984	★☆☆☆☆ Found in Text Mining only
Plasmablastic Lymphoma	Associate	15578069, 35523507	★☆☆☆☆ Found in Text Mining only
Pleural Effusion	Associate	1371640, 18925324, 19414323, 24069325, 24134738, 27586092, 7890378, 8100745	★☆☆☆☆ Found in Text Mining only
Pleural Effusion Malignant	Associate	14612896, 18064389, 29785404, 30816121, 39325190	★☆☆☆☆ Found in Text Mining only
Pneumonia	Associate	12952926, 30644704, 31310589, 36171010, 37459093, 37497667	★☆☆☆☆ Found in Text Mining only
Pneumonia	Inhibit	31842954, 35095920, 40190436	★☆☆☆☆ Found in Text Mining only
Pneumonia Pneumocystis	Associate	32911508, 9769325	★☆☆☆☆ Found in Text Mining only
Poliomyelitis	Associate	26271191	★☆☆☆☆ Found in Text Mining only
Polychondritis Relapsing	Associate	15147365	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	30988342, 34847942, 37226082, 38189053, 39754246	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Associate	35025147	★☆☆☆☆ Found in Text Mining only
Polymyalgia Rheumatica	Associate	14672892	★☆☆☆☆ Found in Text Mining only
Polymyositis	Associate	17195241, 19953283, 30157932	★☆☆☆☆ Found in Text Mining only
Polyps	Associate	17063750, 26684290, 33817728	★☆☆☆☆ Found in Text Mining only
Post Acute COVID 19 Syndrome	Associate	33993490, 34611034, 35746736, 37753077, 39284068, 39615603	★☆☆☆☆ Found in Text Mining only
Post Infectious Disorders	Associate	37471146	★☆☆☆☆ Found in Text Mining only
Pouchitis	Stimulate	9824577	★☆☆☆☆ Found in Text Mining only
Pre Eclampsia	Stimulate	12623476, 36708687	★☆☆☆☆ Found in Text Mining only
Pre Eclampsia	Associate	22837649, 28502089	★☆☆☆☆ Found in Text Mining only
Pre Eclampsia	Inhibit	26515425, 37921073	★☆☆☆☆ Found in Text Mining only
Precancerous Conditions	Associate	35947128, 38366919	★☆☆☆☆ Found in Text Mining only
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	21923643, 8652829	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	16459188, 1672098, 2195543, 2365056, 23975177, 26474588, 2822168, 3259951, 40076625	★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	16371020, 28801656, 3058229, 7519476	★☆☆☆☆ Found in Text Mining only
Prediabetic State	Associate	34737186	★☆☆☆☆ Found in Text Mining only
Premature Birth	Stimulate	21347427	★☆☆☆☆ Found in Text Mining only
Premature Birth	Associate	36027951	★☆☆☆☆ Found in Text Mining only
Prieto X linked mental retardation syndrome	Associate	12699424	★☆☆☆☆ Found in Text Mining only
Primary Immunodeficiency Diseases	Associate	31572362, 33193371, 37161048	★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Inhibit	21282192	★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Associate	32732359, 34238135	★☆☆☆☆ Found in Text Mining only
Prodromal Symptoms	Associate	19779716	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Associate	22157983, 34606081	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Associate	29105795	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	12077288, 18519750, 22647697, 25119597, 28681697, 29105795, 31355524, 32923127, 33785258, 33837451, 33985534, 34806485, 35764368, 36499557, 36686485, 36759726, 37857190, 38062230, 40121536, 9627224	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms Castration Resistant	Associate	23319273	★☆☆☆☆ Found in Text Mining only
Prostatitis	Associate	30378157	★☆☆☆☆ Found in Text Mining only
Prosthesis Failure	Associate	19214244, 28213791	★☆☆☆☆ Found in Text Mining only
Proteinuria	Associate	24774748	★☆☆☆☆ Found in Text Mining only
Pruritus	Associate	35523507	★☆☆☆☆ Found in Text Mining only
Psoriasis	Associate	20943046, 22291603, 23750651, 24286492, 25568543, 29280140, 30747724, 34108969, 7653183	★☆☆☆☆ Found in Text Mining only
Psychological Distress	Associate	26173605	★☆☆☆☆ Found in Text Mining only
Psychological Distress	Stimulate	37815881	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Associate	34233597, 35960497, 36248192, 36555549, 37753829, 39769220	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	16246539, 18684844, 19220836, 19378224, 19604272, 19729666, 21651772, 22183488, 23374856, 24805101, 25315895, 25375131, 27549738, 27613775, 27793198, 28053515, 29179729, 30842769, 30988604, 31141166, 31440043, 33223825, 33317530, 33435988, 34426754, 35096207, 35740993, 35991707, 36127695, 37286295, 39346628, 40234829	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Stimulate	17050556, 28934595	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Inhibit	25137293, 29206476, 33651771, 34435653	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Inhibit	25010330	★☆☆☆☆ Found in Text Mining only
Pulmonary Embolism	Associate	35572511	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Associate	18062794	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Associate	18250483, 25536276, 37731513, 7905208	★☆☆☆☆ Found in Text Mining only
Purpura	Associate	25736842	★☆☆☆☆ Found in Text Mining only
Purpura Thrombocytopenic Idiopathic	Associate	10583274, 16212887, 18519809, 19056692, 23215839, 24338252, 24433164, 25561904, 25978334, 26287565, 28054583, 28419421, 29333980, 30403287, 30944836, 31273052, 31651870, 31866622, 32419211, 32574429, 34144109, 34329516, 34445858, 37291547, 37660478, 38184203	★☆☆☆☆ Found in Text Mining only
Purpura Thrombocytopenic Idiopathic	Inhibit	1840468, 22875869	★☆☆☆☆ Found in Text Mining only
Purpura Thrombotic Thrombocytopenic	Associate	26747250	★☆☆☆☆ Found in Text Mining only
Purpura Thrombotic Thrombocytopenic	Inhibit	35507753	★☆☆☆☆ Found in Text Mining only
Pyruvate Carboxylase Deficiency Disease	Associate	1929608	★☆☆☆☆ Found in Text Mining only
Q Fever	Associate	22098165, 25211350, 9008288	★☆☆☆☆ Found in Text Mining only
Radiation Injuries	Associate	23559597	★☆☆☆☆ Found in Text Mining only
Radicular Cyst	Associate	39972438	★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Associate	27053849, 34531868, 35534879	★☆☆☆☆ Found in Text Mining only
Recurrent respiratory papillomatosis	Associate	22322668, 28805308	★☆☆☆☆ Found in Text Mining only
Red Cell Aplasia Pure	Associate	10583274, 16044445	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Inhibit	12719595, 19417582	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Associate	16796525, 1827129, 18454861, 19417582, 19918105, 19949656, 21917895, 22739389, 23280237, 23289841, 24583671, 25166019, 25428920, 26584666, 26627102, 27191978, 27355415, 28086929, 28387865, 28604824, 29672676, 30063722, 33151020	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Stimulate	25935494	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency Chronic	Associate	21873805, 21993694, 24347824, 29619880	★☆☆☆☆ Found in Text Mining only
Reperfusion Injury	Associate	19283744, 37105441	★☆☆☆☆ Found in Text Mining only
Reproductive Tract Infections	Associate	23555586	★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Associate	34898369, 36809070, 40190436	★☆☆☆☆ Found in Text Mining only
Respiratory Insufficiency	Inhibit	32320677	★☆☆☆☆ Found in Text Mining only
Respiratory Sounds	Associate	18614563, 31901157	★☆☆☆☆ Found in Text Mining only
Respiratory Syncytial Virus Infections	Associate	26162090	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Associate	40234829	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Associate	17362263	★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Associate	36499121	★☆☆☆☆ Found in Text Mining only
Retinal Dysplasia	Associate	31343468, 34919260	★☆☆☆☆ Found in Text Mining only
Retinoschisis	Associate	33601057	★☆☆☆☆ Found in Text Mining only
Retroperitoneal Neoplasms	Associate	33974080	★☆☆☆☆ Found in Text Mining only
Retroviridae Infections	Associate	32907866	★☆☆☆☆ Found in Text Mining only
Rheumatic Diseases	Associate	26076982, 32878464	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Associate	28143491	★☆☆☆☆ Found in Text Mining only
Rhinitis	Associate	30537802	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Associate	17156343, 17349011, 18797179, 21919915, 24514067, 30537802, 33224143, 36149748, 36713372	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Stimulate	12653839	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Associate	21975176, 22670772, 22701743, 24062574, 24391521, 24834772, 35942560	★☆☆☆☆ Found in Text Mining only
Ring Chromosome 20 Syndrome	Inhibit	39367456	★☆☆☆☆ Found in Text Mining only
Robinow Syndrome	Associate	9321759	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Associate	34668039	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Inhibit	34668039	★☆☆☆☆ Found in Text Mining only
Rupture	Associate	19394279, 19843577	★☆☆☆☆ Found in Text Mining only
Salivary Gland Diseases	Associate	34925329, 9038756	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Associate	10092696, 10908151, 11091281, 11923555, 14508706, 17975675, 18279440, 19480659, 19536643, 21177920, 21959269, 22469005, 22537923, 23630356, 23863960, 24681356, 25004830, 25073001, 26415669, 2669224, 27230441, 27575817, 28827283, 30585624, 32063460, 32508528, 33363531, 35761164, 36613701, 37520566, 37863732, 38097354, 7586698, 7910965, 8529107, 8881751, 9311498	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Inhibit	24882950, 8143813	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Stimulate	30452447, 8137547, 9176534	★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Associate	11359967, 23630356, 26585430, 29055517, 29234685, 34753769	★☆☆☆☆ Found in Text Mining only
Sarcoma	Inhibit	36005179	★☆☆☆☆ Found in Text Mining only
Sarcoma	Associate	37192046	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Inhibit	34440851	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Associate	11165927, 22045987, 22787430, 29746555, 33799006, 7521102	★☆☆☆☆ Found in Text Mining only
Sarcosinemia	Associate	28387599	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Associate	27244229, 37552420	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Stimulate	38066312	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Associate	15730402, 19536281, 20973920, 2138008, 21996293, 27145754, 29248544, 31767698, 32977850, 33307312, 35183246, 35663995, 8484693	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Stimulate	31848026	★☆☆☆☆ Found in Text Mining only
Seizures	Associate	23639073, 38057734	★☆☆☆☆ Found in Text Mining only
Sepsis	Associate	27459386, 30327490, 30470767, 31484735, 35720398	★☆☆☆☆ Found in Text Mining only
Sepsis	Stimulate	34898369, 36250055	★☆☆☆☆ Found in Text Mining only
Sepsis	Inhibit	40190436	★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Inhibit	12955652, 32217835	★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Associate	16937439, 17872527, 21813600, 28426727, 33902571, 35673765	★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Associate	11110711, 1320968, 27301863, 7905018, 8287598, 8920891, 9446656, 9664084	★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Associate	18218852, 9420304	★☆☆☆☆ Found in Text Mining only
Severe Dengue	Associate	17626101	★☆☆☆☆ Found in Text Mining only
Severe Fever with Thrombocytopenia Syndrome	Associate	37903435	★☆☆☆☆ Found in Text Mining only
Sexually Transmitted Diseases	Associate	22190722, 31619762	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Associate	11168816, 11348462, 11442758, 12200382, 12437636, 1381718, 15009733, 15245439, 15315967, 1562047, 16418328, 17713571, 18314443, 19211505, 1987293, 19935642, 20663947, 20713771, 20801618, 21085192, 21191411, 23792457, 25806852, 26930587, 27732942, 27766406, 27889686, 28441377, 32760603, 35533722, 7777538, 9717967	★☆☆☆☆ Found in Text Mining only
Shock	Associate	37614152	★☆☆☆☆ Found in Text Mining only
Shock Septic	Associate	33613540	★☆☆☆☆ Found in Text Mining only
Sialadenitis	Associate	27358392	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Associate	10403921	★☆☆☆☆ Found in Text Mining only
Sickle Cell Trait	Associate	34496009	★☆☆☆☆ Found in Text Mining only
Signs and Symptoms Digestive	Associate	31457091	★☆☆☆☆ Found in Text Mining only
Silicosis	Associate	16831302, 21244759, 36587204	★☆☆☆☆ Found in Text Mining only
Simian Acquired Immunodeficiency Syndrome	Associate	23185351	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Associate	10446867, 1720300, 18684981, 23738744, 24117612, 24574234, 26436101, 27346388, 27461134, 28494936, 28621822, 28743286, 29453859, 30336792, 30589451, 30632148, 33050949, 33179091, 33603736, 33883324, 33936039, 34095321, 35944186, 36171070, 37569326, 39480501, 40257948, 40650157, 7683586	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Stimulate	32963045, 34641948, 36505431	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Inhibit	7578884, 8082485	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Associate	10504451, 10886244, 11511293, 12750155, 1673877, 16782037, 22992805, 23566249, 24286492, 24335103, 34220814	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Associate	12576313	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Stimulate	19581829	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Associate	18004564, 32020764, 33674986, 34006632, 35834843	★☆☆☆☆ Found in Text Mining only
Smoke Inhalation Injury	Inhibit	40345896	★☆☆☆☆ Found in Text Mining only
Soft Tissue Injuries	Associate	33893236	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Associate	19740340	★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Associate	15864353, 17483473, 18664281, 20945034, 24960164	★☆☆☆☆ Found in Text Mining only
Spinal Cord Injuries	Associate	38139422	★☆☆☆☆ Found in Text Mining only
Splenic Neoplasms	Associate	23037630	★☆☆☆☆ Found in Text Mining only
Splenic Neoplasms	Inhibit	35610016	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Associate	11207664, 12932293, 15498047, 16180249, 16277694, 20722024, 21248258, 26841353, 27901054, 29960293, 34108969	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Inhibit	25142923	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	12716470, 17235436, 18221909, 18547033, 18559587, 19825957, 20857101, 21442435, 22252752, 22252753, 23826668, 23977174, 24761979, 25153698, 26313665, 26740106, 28574843, 28947422, 29416107, 31662531, 31924475, 32441311, 32719094, 33010009, 33053760, 33125511, 33173143, 33307825, 33390791, 33457076, 33462898, 33513276, 33529452, 33995377, 34373557, 34531868, 34626165, 35039463, 36319566, 36425786, 36512410, 36627705, 36864443, 36930079, 37270478, 37459093, 37828063, 37898859, 38077321, 38129784, 7961115	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Stimulate	32383556	★☆☆☆☆ Found in Text Mining only
Squamous Intraepithelial Lesions	Associate	33605553	★☆☆☆☆ Found in Text Mining only
Squamous Intraepithelial Lesions	Stimulate	34919260	★☆☆☆☆ Found in Text Mining only
ST Elevation Myocardial Infarction	Associate	26375412, 35354890	★☆☆☆☆ Found in Text Mining only
Status Asthmaticus	Associate	11429397, 12952249, 15944327, 16883065, 19473523, 20059479, 20926789, 20943044, 21917308, 23110234, 23893806, 24934276, 27708065, 30644695, 31685437, 32914944, 33271553, 38129444, 7596088, 9108409	★☆☆☆☆ Found in Text Mining only
Stevens Johnson Syndrome	Associate	11004109, 37074725	★☆☆☆☆ Found in Text Mining only
Stiff Skin Syndrome	Stimulate	25314253	★☆☆☆☆ Found in Text Mining only
Still's Disease Adult Onset	Inhibit	30052100	★☆☆☆☆ Found in Text Mining only
Still's Disease Adult Onset	Associate	34319596	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Associate	27306341	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	12942579, 14568977, 20819431, 21528082, 23365642, 2522349, 25260881, 26464703, 27323782, 28488547, 30988066, 31631566, 32028262, 32129682, 32987562, 33312758, 33426088, 33492335, 33837660, 33843442, 34746312, 34868341, 34968167, 35382776, 36249422, 36737759, 37342362, 37359529, 37366273, 37467193, 37499395, 37781029, 38042786, 38090588, 38259671, 38368775, 39299554, 39328412, 39781526	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stimulate	15618192, 37153541	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Inhibit	37904396	★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Associate	21478439	★☆☆☆☆ Found in Text Mining only
Stroke	Associate	24650222, 29697202, 33205448	★☆☆☆☆ Found in Text Mining only
Subcutaneous panniculitis like T cell lymphoma	Associate	17934071	★☆☆☆☆ Found in Text Mining only
Syndrome	Associate	33179091, 33332284	★☆☆☆☆ Found in Text Mining only
Syndrome	Inhibit	34916230	★☆☆☆☆ Found in Text Mining only
Synovial Cyst	Associate	16838043	★☆☆☆☆ Found in Text Mining only
Synovitis	Associate	17907166, 9260157	★☆☆☆☆ Found in Text Mining only
Syphilis	Associate	32873094	★☆☆☆☆ Found in Text Mining only
T cell immunodeficiency primary	Associate	1380169, 9626046	★☆☆☆☆ Found in Text Mining only
T Lymphocytopenia	Associate	18166773, 19039197	★☆☆☆☆ Found in Text Mining only
T Lymphocytopenia Idiopathic CD4 Positive	Associate	18456875, 19039197, 23383227, 25733583, 37133586, 8609222	★☆☆☆☆ Found in Text Mining only
T Lymphocytopenia Idiopathic CD4 Positive	Inhibit	22454463, 31781092	★☆☆☆☆ Found in Text Mining only
Tachycardia Atrioventricular Nodal Reentry	Stimulate	23826668	★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Associate	15544635, 31888748, 33538119, 9030862	★☆☆☆☆ Found in Text Mining only
Tang Hsi Ryu syndrome	Associate	30336792, 33196557, 38022535	★☆☆☆☆ Found in Text Mining only
Tangier Disease	Associate	30092832	★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Associate	23772771	★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Associate	26763360, 29749506, 30670769, 32963045	★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Stimulate	33796412	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Associate	34531868	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Associate	16030183, 28555838, 32744608	★☆☆☆☆ Found in Text Mining only
Tetany	Stimulate	19903780, 21690475	★☆☆☆☆ Found in Text Mining only
Tetany	Associate	25617427, 26271191	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Associate	35586668	★☆☆☆☆ Found in Text Mining only
Thrombosis	Associate	40190436	★☆☆☆☆ Found in Text Mining only
Thrombotic thrombocytopenic purpura acquired	Associate	26747250	★☆☆☆☆ Found in Text Mining only
Thymoma	Associate	10403908, 10886240, 12820694, 14575152, 19886737, 34531868, 9867130	★☆☆☆☆ Found in Text Mining only
Thymus Neoplasms	Associate	12116341, 2783859, 38071307, 9345067	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Associate	36319978	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	34465342, 34790166	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	1375873, 27045886, 34539667	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Associate	32323619	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Associate	14971052, 15147360, 16698664, 19040601, 27855396, 32045626, 34144109, 37501789, 40155866	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Stimulate	18637101	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Inhibit	23249428, 27206624	★☆☆☆☆ Found in Text Mining only
Thyroiditis Chronic	Inhibit	21147625	★☆☆☆☆ Found in Text Mining only
Thyroiditis Subacute	Associate	37451415	★☆☆☆☆ Found in Text Mining only
Tic Disorders	Inhibit	34257142	★☆☆☆☆ Found in Text Mining only
Tn Syndrome	Associate	32961930	★☆☆☆☆ Found in Text Mining only
Tongue Diseases	Stimulate	11986779	★☆☆☆☆ Found in Text Mining only
Tonsillitis	Associate	28877231, 30728285, 34045665	★☆☆☆☆ Found in Text Mining only
Tooth Erosion	Associate	27306341	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Associate	26709833	★☆☆☆☆ Found in Text Mining only
Toxoplasmosis	Inhibit	36840494	★☆☆☆☆ Found in Text Mining only
Toxoplasmosis Cerebral	Associate	32364106	★☆☆☆☆ Found in Text Mining only
Toxoplasmosis Ocular	Associate	23100559, 39277179	★☆☆☆☆ Found in Text Mining only
Tracheal Stenosis	Associate	37647429	★☆☆☆☆ Found in Text Mining only
Translocation Genetic	Associate	25225461	★☆☆☆☆ Found in Text Mining only
Trauma Nervous System	Associate	39352388	★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Associate	12121441	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	27727484, 30221739, 30305342, 32529292, 32971948, 33301062, 34789319, 35705026, 35797509, 36412444, 37090736, 37199043, 37810779, 38308298, 39643914	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Stimulate	38170155	★☆☆☆☆ Found in Text Mining only
Tuberculosis	Associate	11972637, 11982602, 12780692, 14678204, 15373915, 15459144, 16542361, 19438599, 21186260, 22087280, 22215422, 22431997, 22719887, 23293360, 24694750, 25520147, 25822019, 25974183, 26611774, 26927799, 27553411, 27861807, 27924827, 30218032, 30231065, 30233588, 30728405, 31678658, 31681314, 31952232, 33720848, 33945513, 34162973, 36619740, 37809012, 38642678, 8565282, 9353145	★☆☆☆☆ Found in Text Mining only
Tuberculosis	Inhibit	16767318	★☆☆☆☆ Found in Text Mining only
Tuberculosis	Stimulate	29489879, 29635002	★☆☆☆☆ Found in Text Mining only
Tuberculosis Central Nervous System	Associate	22111973	★☆☆☆☆ Found in Text Mining only
Tuberculosis Extrapulmonary	Associate	22215422, 33391271	★☆☆☆☆ Found in Text Mining only
Tuberculosis Lymph Node	Associate	1440463	★☆☆☆☆ Found in Text Mining only
Tuberculosis Meningeal	Associate	15708307, 22961735, 23826366, 23840403, 27383726, 27861807, 34176483, 35552657, 36040958	★☆☆☆☆ Found in Text Mining only
Tuberculosis Multidrug Resistant	Inhibit	20655262	★☆☆☆☆ Found in Text Mining only
Tuberculosis Multidrug Resistant	Associate	27681197, 33977111	★☆☆☆☆ Found in Text Mining only
Tuberculosis Pleural	Associate	21625607, 21887301, 24069325, 24134738, 37809012	★☆☆☆☆ Found in Text Mining only
Tuberculosis Pleural	Stimulate	21829471	★☆☆☆☆ Found in Text Mining only
Tuberculosis Pulmonary	Associate	11722641, 11748166, 1440463, 15459144, 28881482, 29472922, 29489879, 30231065, 35293343, 39337460	★☆☆☆☆ Found in Text Mining only
Tumor Virus Infections	Associate	33310773	★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Stimulate	26496037	★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Associate	26709833	★☆☆☆☆ Found in Text Mining only
Ureteral Neoplasms	Associate	29243545	★☆☆☆☆ Found in Text Mining only
Urethral Neoplasms	Associate	34220837, 36939254	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	19692168, 26862849, 26927070, 29478100, 30075815, 32228629, 32497499, 34531868, 35669725, 35958598, 36162993, 37313656, 37632832	★☆☆☆☆ Found in Text Mining only
Urogenital Neoplasms	Associate	33262136	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Associate	12121440, 33007050	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	10364287, 10864677, 17615234, 19386711, 22094905, 26486970, 31562978, 32306508, 32518078, 33605553, 37344577, 38084896, 9621091	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Stimulate	17937675, 23587428	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Inhibit	33694292	★☆☆☆☆ Found in Text Mining only
Uterine Cervicitis	Associate	29454382, 33007050	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Associate	36552753	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Associate	19557412, 26712692, 32496920, 34531868	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Associate	14977779, 15196263, 23527071, 32479651	★☆☆☆☆ Found in Text Mining only
Uveitis	Stimulate	23818738	★☆☆☆☆ Found in Text Mining only
Uveitis Anterior	Associate	15043537	★☆☆☆☆ Found in Text Mining only
Uveitis Intermediate	Stimulate	10361227	★☆☆☆☆ Found in Text Mining only
Uveitis Posterior	Associate	7882564	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Associate	21297967, 28761327	★☆☆☆☆ Found in Text Mining only
Vaginosis Bacterial	Associate	30407498	★☆☆☆☆ Found in Text Mining only
Varicocele	Stimulate	32635770	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Associate	15171817, 26603521, 28972094, 33196557, 35883458, 8669478	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Associate	17919564, 20430391, 25484131	★☆☆☆☆ Found in Text Mining only
Vasculitis	Associate	19381293, 21484763, 28916770, 30510966, 34950150, 37952293, 9808568	★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Associate	35883458	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Associate	25001165	★☆☆☆☆ Found in Text Mining only
Viremia	Associate	11717444, 15117455, 16246391, 16272355, 16809324, 19535437, 19690337, 19911963, 22287716, 24148296, 26068923, 26842474, 31118290, 31677350, 36450262, 36602866	★☆☆☆☆ Found in Text Mining only
Virus Diseases	Associate	10220446, 11533159, 15284108, 20147895, 23185351, 23569328, 24194773, 24391825, 26776123, 30459072, 30692574, 31440240, 32668411, 33228556, 33965183, 34095321, 35660868, 36450262, 36596303, 36841352, 37669378, 38129444	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Associate	34764490	★☆☆☆☆ Found in Text Mining only
Vitiligo	Associate	18548110, 34107850, 37731844, 7871844	★☆☆☆☆ Found in Text Mining only
Vitiligo	Inhibit	33200798	★☆☆☆☆ Found in Text Mining only
Vulvar Lichen Sclerosus	Associate	33438816	★☆☆☆☆ Found in Text Mining only
Warts	Associate	31781092, 34916230	★☆☆☆☆ Found in Text Mining only
Wells syndrome	Associate	17362263	★☆☆☆☆ Found in Text Mining only
West Nile Fever	Associate	32038660	★☆☆☆☆ Found in Text Mining only
White Coat Hypertension	Associate	18689680, 31581595	★☆☆☆☆ Found in Text Mining only
Whooping Cough	Associate	22550536, 24176499, 25787136	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Associate	30981637, 34597382	★☆☆☆☆ Found in Text Mining only
Winter Shortland Temple syndrome	Associate	29367348	★☆☆☆☆ Found in Text Mining only
Wiskott Aldrich Syndrome	Associate	1512549, 17082665, 27396937, 8918565	★☆☆☆☆ Found in Text Mining only
Wolf Hirschhorn Syndrome	Associate	37073435	★☆☆☆☆ Found in Text Mining only
Wounds and Injuries	Stimulate	28671900	★☆☆☆☆ Found in Text Mining only
Wounds and Injuries	Associate	33966343, 9804349	★☆☆☆☆ Found in Text Mining only
ZAP70 deficiency	Associate	33471124	★☆☆☆☆ Found in Text Mining only
Zika Virus Infection	Associate	32132999	★☆☆☆☆ Found in Text Mining only