Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	91975
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger protein 300
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZNF300
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q33.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a C2H2-type zinc finger DNA binding protein and likely transcriptional regulator. The function of this protein is not yet known. Three transcript variants encoding different isoforms have been found for this gene.[provi

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439210	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT439210	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT1521597	hsa-miR-198	CLIP-seq
MIRT1521598	hsa-miR-338-5p	CLIP-seq
MIRT1521599	hsa-miR-3686	CLIP-seq
MIRT1521600	hsa-miR-4668-5p	CLIP-seq
MIRT1521601	hsa-miR-4742-3p	CLIP-seq
MIRT1521602	hsa-miR-4778-5p	CLIP-seq
MIRT1521603	hsa-miR-520a-5p	CLIP-seq
MIRT1521604	hsa-miR-525-5p	CLIP-seq
MIRT1521605	hsa-miR-759	CLIP-seq
MIRT1521606	hsa-miR-891b	CLIP-seq
MIRT1521607	hsa-miR-1294	CLIP-seq
MIRT1521608	hsa-miR-148a	CLIP-seq
MIRT1521609	hsa-miR-148b	CLIP-seq
MIRT1521610	hsa-miR-152	CLIP-seq
MIRT1521611	hsa-miR-1827	CLIP-seq
MIRT1521612	hsa-miR-3126-3p	CLIP-seq
MIRT1521613	hsa-miR-3159	CLIP-seq
MIRT1521614	hsa-miR-3176	CLIP-seq
MIRT1521615	hsa-miR-3922-3p	CLIP-seq
MIRT1521616	hsa-miR-4307	CLIP-seq
MIRT1521617	hsa-miR-4316	CLIP-seq
MIRT1521618	hsa-miR-4677-3p	CLIP-seq
MIRT1521619	hsa-miR-4679	CLIP-seq
MIRT1521620	hsa-miR-4757-5p	CLIP-seq
MIRT2157438	hsa-miR-3691-3p	CLIP-seq
MIRT1521597	hsa-miR-198	CLIP-seq
MIRT1521600	hsa-miR-4668-5p	CLIP-seq
MIRT2377037	hsa-miR-4724-5p	CLIP-seq
MIRT1521603	hsa-miR-520a-5p	CLIP-seq
MIRT1521604	hsa-miR-525-5p	CLIP-seq
MIRT1521605	hsa-miR-759	CLIP-seq
MIRT2669328	hsa-miR-129-5p	CLIP-seq
MIRT2669329	hsa-miR-4274	CLIP-seq
MIRT2669330	hsa-miR-4519	CLIP-seq
MIRT2669331	hsa-miR-4524	CLIP-seq
MIRT2669332	hsa-miR-4714-3p	CLIP-seq
MIRT2669333	hsa-miR-513b	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
SPI1	Unknown	20471086

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	20585888
GO:0005515	Function	Protein binding	IPI	23665872
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	23665872
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0016604	Component	Nuclear body	IDA
GO:0043565	Function	Sequence-specific DNA binding	IDA	20585888
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20585888
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
612429	13091	ENSG00000145908

Protein

UniProt ID

Q96RE9

Protein name

Zinc finger protein 300

Protein function

Has a transcriptional repressor activity.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	7 → 48	KRAB box	Family
PF00096	zf-C2H2	269 → 291	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	297 → 319	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	325 → 347	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	353 → 375	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	381 → 403	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	409 → 431	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	437 → 459	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	465 → 487	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	493 → 515	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	521 → 543	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	549 → 571	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	577 → 599	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed mostly in heart, skeletal muscle and brain. Isoform 1 and isoform 2 are highly expressed in testis. {ECO:0000269|PubMed:14746915, ECO:0000269|PubMed:17541838}.

Sequence

MMKSQGLVSFKDVAVDFTQEEWQQLDPSQRTLYRDVMLENYSHLVSMGYPVSKPDVISKL
EQGEEPWIIKGDISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGS
LCSILKVCQGDGQLQRFLENQDKLFRQVTFVNSKTVTEASGHKYNPLGKIFQECIETDIS
IQRFHKYDAFKKNLKPNIDLPSCYKSNSRKKPDQSFGGGKSSSQSEPNSNLEKIHNGVIP
FDDNQCGNVFRNTQSLIQYQNVETKEKSCVCVTCGKAFAKKSQLIVHQRIHTGKKPYDCG
ACGKAFSEKFHLVVHQRTHTGEKPYDCSECGKAFSQKSSLIIHQRVHTGEKPYECSECGK
AFSQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQLIIHHRAHTGEKPYECTECGKAFCE
KSHLIIHKRIHTGEKPYKCAQCEEAFSRKTELITHQLVHTGEKPYECTECGKTFSRKSQL
IIHQRTHTGEKPYKCSECGKAFCQKSHLIGHQRIHTGEKPYICTECGKAFSQKSHLPGHQ
RIHTGEKPYICAECGKAFSQKSDLVLHQRIHTGERPYQCAICGKAFIQKSQLTVHQRIHT
VVKS

Sequence length

604

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	28067908, 23128233

Show/Hide Unknown Diseases (5)

Disease term	Disease name	References	Source
Unknown
Crohn disease	Crohn Disease	28067908, 26192919	ClinVar
Inflammatory Bowel Disease	Inflammatory Bowel Disease		GWAS
Crohn Disease	Crohn Disease		GWAS
Ulcerative colitis	Ulcerative colitis		GWAS
Dementia	Dementia		GWAS

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining
Crohn Disease	Associate	20106866
Fetal Growth Retardation	Associate	27330572
Leukemia Myeloid Acute	Associate	33219204
Lymphoma B Cell	Associate	8274740
Myelodysplastic Syndromes	Associate	33219204
Wilms Tumor	Associate	2154702

ZNF300 (zinc finger protein 300)