Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
91975
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 300
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF300
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q33.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a C2H2-type zinc finger DNA binding protein and likely transcriptional regulator. The function of this protein is not yet known. Three transcript variants encoding different isoforms have been found for this gene.[provi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT439210 hsa-miR-155-5p HITS-CLIP 22473208
MIRT439210 hsa-miR-155-5p HITS-CLIP 22473208
MIRT1521597 hsa-miR-198 CLIP-seq
MIRT1521598 hsa-miR-338-5p CLIP-seq
MIRT1521599 hsa-miR-3686 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
SPI1 Unknown 20471086
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 20585888
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
GO:0003677 Function DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612429 13091 ENSG00000145908
Protein
UniProt ID Q96RE9
Protein name Zinc finger protein 300
Protein function Has a transcriptional repressor activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 7 48 KRAB box Family
PF00096 zf-C2H2 269 291 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 297 319 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 325 347 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 353 375 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 381 403 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 409 431 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 437 459 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 465 487 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 493 515 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 521 543 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 549 571 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 577 599 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed mostly in heart, skeletal muscle and brain. Isoform 1 and isoform 2 are highly expressed in testis. {ECO:0000269|PubMed:14746915, ECO:0000269|PubMed:17541838}.
Sequence
MMKSQGLVSFKDVAVDFTQEEWQQLDPSQRTLYRDVMLENYSHLVSMGYPVSKPDVISKL
EQGEEPWIIKGDISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGS
LCSILKVCQGDGQLQRFLENQDKLFRQVTFVNSKTVTEASGHKYNPLGKIFQECIETDIS
IQRFHKYDAFKKNLKPNIDLPSCYKSNSRKKPDQSFGGGKSSSQSEPNSNLEKIHNGVIP
FDDNQCGNVFRNTQSLIQYQNVETKEKSCVCVTCGKAFAKKSQLIVHQRIHTGKKPYDCG
ACGKAFSEKFHLVVHQRTH
TGEKPYDCSECGKAFSQKSSLIIHQRVHTGEKPYECSECGK
AFSQKSPLIIHQRIH
TGEKPYECRECGKAFSQKSQLIIHHRAHTGEKPYECTECGKAFCE
KSHLIIHKRIH
TGEKPYKCAQCEEAFSRKTELITHQLVHTGEKPYECTECGKTFSRKSQL
IIHQRTH
TGEKPYKCSECGKAFCQKSHLIGHQRIHTGEKPYICTECGKAFSQKSHLPGHQ
RIH
TGEKPYICAECGKAFSQKSDLVLHQRIHTGERPYQCAICGKAFIQKSQLTVHQRIHT
VVKS
Sequence length 604
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Crohn Disease Crohn's disease N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease (MTAG), Inflammatory bowel disease N/A N/A GWAS
Ulcerative colitis Ulcerative colitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Crohn Disease Associate 20106866
Fetal Growth Retardation Associate 27330572
Leukemia Myeloid Acute Associate 33219204
Lymphoma B Cell Associate 8274740
Myelodysplastic Syndromes Associate 33219204
Wilms Tumor Associate 2154702