KCNAB3 (potassium voltage-gated channel subfamily A regulatory beta subunit 3)

Gene

• Entrez ID: 9196
• Gene name: Potassium voltage-gated channel subfamily A regulatory beta subunit 3
• Gene symbol: KCNAB3
• Synonyms (NCBI Gene): AKR6A9, KCNA3.1B, KCNA3B, KV-BETA-3
• Chromosome: 17
• Chromosome location: 17p13.1
• Summary: This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. The encoded protein is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. The encoded protein forms a heterodi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1080408	hsa-let-7a	CLIP-seq
MIRT1080409	hsa-let-7b	CLIP-seq
MIRT1080410	hsa-let-7c	CLIP-seq
MIRT1080411	hsa-let-7d	CLIP-seq
MIRT1080412	hsa-let-7e	CLIP-seq
MIRT1080413	hsa-let-7f	CLIP-seq
MIRT1080414	hsa-let-7g	CLIP-seq
MIRT1080415	hsa-let-7i	CLIP-seq
MIRT1080416	hsa-miR-1206	CLIP-seq
MIRT1080417	hsa-miR-1304	CLIP-seq
MIRT1080418	hsa-miR-135a	CLIP-seq
MIRT1080419	hsa-miR-135b	CLIP-seq
MIRT1080420	hsa-miR-202	CLIP-seq
MIRT1080421	hsa-miR-296-5p	CLIP-seq
MIRT1080422	hsa-miR-297	CLIP-seq
MIRT1080423	hsa-miR-3119	CLIP-seq
MIRT1080424	hsa-miR-3201	CLIP-seq
MIRT1080425	hsa-miR-375	CLIP-seq
MIRT1080426	hsa-miR-4458	CLIP-seq
MIRT1080427	hsa-miR-4500	CLIP-seq
MIRT1080428	hsa-miR-4791	CLIP-seq
MIRT1080429	hsa-miR-567	CLIP-seq
MIRT1080430	hsa-miR-98	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005249	Function	Voltage-gated potassium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	TAS	9857044
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008106	Function	Alcohol dehydrogenase (NADP+) activity	IBA
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	TAS	9857044
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0044325	Function	Transmembrane transporter binding	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IBA

Other IDs

• MIM: 604111
• HGNC: 6230
• e!Ensembl: ENSG00000170049

Protein

• UniProt ID: O43448
• Protein name: Voltage-gated potassium channel subunit beta-3 (EC 1.1.1.-) (K(+) channel subunit beta-3) (Kv-beta-3)
• Protein function: Regulatory subunit of the voltage-gated potassium (Kv) channels composed of pore-forming and potassium-conducting alpha subunits and of regulatory beta subunit (PubMed:9857044). The beta-3/KCNAB3 subunit may mediate closure of potassium channels
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00248	Aldo_ket_red	92 → 396	Aldo/keto reductase family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Brain specific. Most prominent expression in cerebellum. Weaker signals detected in cortex, occipital lobe, frontal lobe and temporal lobe. Not detected in spinal cord, heart, lung, liver, kidney, pancreas, placenta and skeletal muscle
• Sequence:

  MQVSIACTEQNLRSRSSEDRLCGPRPGPGGGNGGPAGGGHGNPPGGGGSGPKARAALVPR
  PPAPAGALRESTGRGTGMKYRNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEH
  GVNLFDTAEVYAAGKAERTLGNILKSKGWRRSSYVITTKIFWGGQAETERGLSRKHIIEG
  LRGSLERLQLGYVDIVFANRSDPNCPMEEIVRAMTYVINQGLALYWGTSRWGAAEIMEAY
  SMARQFNLIPPVCEQAEHHLFQREKVEMQLPELYHKIGVGSVTWYPLACGLITSKYDGRV
  PDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQLGCTVAQLAIAWCLRSEGVSS
  VLLGVSSAEQLIEHLGALQVLSQLTPQTVMEIDGLLGNKPHSKK

• Sequence length: 404

Pathways

Reactome:

Voltage gated Potassium channels