Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9184
Gene name Gene Name - the full gene name approved by the HGNC.
BUB3 mitotic checkpoint protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BUB3
Synonyms (NCBI Gene) Gene synonyms aliases
BUB3L, hBUB3
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q26.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT032111 hsa-let-7d-5p Sequencing 20371350
MIRT039843 hsa-miR-615-3p CLASH 23622248
MIRT039843 hsa-miR-615-3p CLASH 23622248
MIRT037378 hsa-miR-744-3p CLASH 23622248
MIRT055863 hsa-miR-548ac HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000775 Component Chromosome, centromeric region IEA
GO:0000776 Component Kinetochore IBA
GO:0000776 Component Kinetochore IDA 9660858
GO:0000776 Component Kinetochore IEA
GO:0005515 Function Protein binding IPI 9660858, 10198256, 11283619, 12762840, 15525512, 17289665, 19407811, 21566117, 21988832, 22000412, 22365833, 24462186, 24462187, 25383541, 25416956, 25852190, 25959826, 26496610, 32707033, 32814053, 33961781, 35271311
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603719 1151 ENSG00000154473
Protein
UniProt ID O43684
Protein name Mitotic checkpoint protein BUB3
Protein function Has a dual function in spindle-assembly checkpoint signaling and in promoting the establishment of correct kinetochore-microtubule (K-MT) attachments. Promotes the formation of stable end-on bipolar attachments. Necessary for kinetochore localiz
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 4 43 WD domain, G-beta repeat Repeat
PF00400 WD40 88 124 WD domain, G-beta repeat Repeat
PF00400 WD40 215 262 WD domain, G-beta repeat Repeat
Sequence
MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVL
DCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTV
KLWD
PRTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKY
QTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAI
SFHNIHNTFATGGSDGFVNIWD
PFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYE
MDDTEHPEDGIFIRQVTDAETKPKSPCT
Sequence length 328
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell cycle
Human T-cell leukemia virus 1 infection
  Inactivation of APC/C via direct inhibition of the APC/C complex
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Cdc20:Phospho-APC/C mediated degradation of Cyclin A
APC/C:Cdc20 mediated degradation of mitotic proteins
APC-Cdc20 mediated degradation of Nek2A
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Childhood asthma exacerbations in long-acting beta2-agonist treatment N/A N/A GWAS
Mosaic Variegated Aneuploidy mosaic variegated aneuploidy syndrome N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 36787437, 37228122
Adrenocortical Carcinoma Associate 30413320
Aneuploidy Associate 29448935, 33564066
Breast Neoplasms Associate 35186236, 35493295
Carcinoma Hepatocellular Associate 32596342, 35493295, 37301543
Carcinoma in Situ Associate 26398519
Carcinoma Non Small Cell Lung Associate 36551208
Colorectal Neoplasms Associate 29448935, 35156516
Elliptocytosis 1 Associate 29448935
Glioblastoma Associate 18694480