Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9180
Gene name Gene Name - the full gene name approved by the HGNC.
Oncostatin M receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
OSMR
Synonyms (NCBI Gene) Gene synonyms aliases
IL-31R-beta, IL-31RB, OSMRB, OSMRbeta, PLCA1
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p13.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the type I cytokine receptor family. The encoded protein heterodimerizes with interleukin 6 signal transducer to form the type II oncostatin M receptor and with interleukin 31 receptor A to form the interleukin 31 receptor, a
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs63750560 G>C Pathogenic Genic downstream transcript variant, coding sequence variant, missense variant, non coding transcript variant
rs63750567 T>C Pathogenic Genic downstream transcript variant, coding sequence variant, missense variant, non coding transcript variant
rs387906821 A>T Pathogenic Non coding transcript variant, genic downstream transcript variant, coding sequence variant, missense variant
rs387906822 C>T Likely-pathogenic, pathogenic Non coding transcript variant, genic downstream transcript variant, coding sequence variant, missense variant
rs387906823 A>C,G Pathogenic Non coding transcript variant, genic downstream transcript variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016997 hsa-miR-335-5p Microarray 18185580
MIRT027517 hsa-miR-98-5p Microarray 19088304
MIRT724297 hsa-miR-25-3p HITS-CLIP 19536157
MIRT724296 hsa-miR-32-5p HITS-CLIP 19536157
MIRT724295 hsa-miR-363-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002675 Process Positive regulation of acute inflammatory response IC 8999038
GO:0004896 Function Cytokine receptor activity IBA
GO:0004896 Function Cytokine receptor activity IEA
GO:0004924 Function Oncostatin-M receptor activity IBA
GO:0004924 Function Oncostatin-M receptor activity IDA 8999038
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601743 8507 ENSG00000145623
Protein
UniProt ID Q99650
Protein name Oncostatin-M-specific receptor subunit beta (Interleukin-31 receptor subunit beta) (IL-31 receptor subunit beta) (IL-31R subunit beta) (IL-31R-beta) (IL-31RB)
Protein function Associates with IL31RA to form the IL31 receptor. Binds IL31 to activate STAT3 and possibly STAT1 and STAT5. Capable of transducing OSM-specific signaling events.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17971 LIFR_D2 28 138 Leukemia inhibitory factor receptor D2 domain Domain
PF00041 fn3 525 609 Fibronectin type III domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in keratinocytes (at protein level) (PubMed:21261663). Expressed at relatively high levels in all neural cells as well as fibroblast and epithelial cells (PubMed:8999038). {ECO:0000269|PubMed:21261663, ECO:0000269|PubMed:8999
Sequence
MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYH
QELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDD
AKFPEPNFWSNWSSWEEV
SVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCY
LEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEP
KDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQ
DSQETYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMTWKVHSIRN
NFTYLCQIELHGEGKMMQYNVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSEWSG
QNFTTLEAAPSEAPDVWRIVSLEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPSS
SELHSIPAPANSTKLILDRCSYQICVIANNSVGASPASVIVISADPENKEVEEERIAGTE
GGFSLSWKPQPGDVIGYVVDWCDHTQDVLGDFQWKNVGPNTTSTVISTDAFRPGVRYDFR
IYGLSTKRI
ACLLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGY
HVYLKSKARQCHPRFEKAVLSDGSECCKYKIDNPEEKALIVDNLKPESFYEFFITPFTSA
GEGPSATFTKVTTPDEHSSMLIHILLPMVFCVLLIMVMCYLKSQWIKETCYPDIPDPYKS
SILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYL
LPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPENVLKALEKN
YMNSLGEIPAGETSLNYVSQLASPMFGDKDSLPTNPVEAPHCSEYKMQMAVSLRLALPPP
TENSSLSSITLLDPGEHYC
Sequence length 979
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
JAK-STAT signaling pathway
  IL-6-type cytokine receptor ligand interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Amyloidosis amyloidosis, primary localized cutaneous, 1 rs63750567, rs63750560, rs387906821, rs387906822, rs387906823 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Carcinoma Basal cell carcinoma N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Localized Cutaneous Amyloidosis familial primary localized cutaneous amyloidosis N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 28729401
Amyloidosis Primary Cutaneous Associate 18179886, 19690585, 25054142, 35714449
Arthritis Associate 24219225
Arthritis Rheumatoid Associate 24219225
Asthma Associate 26956917
Breast Neoplasms Associate 30755233
Carcinogenesis Associate 20187983
Carcinoma Hepatocellular Associate 17028186, 30945699
Carcinoma Pancreatic Ductal Associate 32615164
Carcinoma Squamous Cell Associate 23765377, 28025425, 35289095