Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	9177
Gene name	5-hydroxytryptamine receptor 3B
Gene symbol	HTR3B
Synonyms (NCBI Gene)	5-HT3B
Chromosome	11
Chromosome location	11q23.2
Summary	The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitoge

105

Show/Hide all (105)

miRTarBase ID	miRNA	Experiments
MIRT1057244	hsa-miR-1182	CLIP-seq
MIRT1057245	hsa-miR-129-5p	CLIP-seq
MIRT1057246	hsa-miR-193a-5p	CLIP-seq
MIRT1057247	hsa-miR-3194-3p	CLIP-seq
MIRT1057248	hsa-miR-342-5p	CLIP-seq
MIRT1057249	hsa-miR-3672	CLIP-seq
MIRT1057250	hsa-miR-431	CLIP-seq
MIRT1057251	hsa-miR-4505	CLIP-seq
MIRT1057252	hsa-miR-4651	CLIP-seq
MIRT1057253	hsa-miR-4664-5p	CLIP-seq
MIRT1057254	hsa-miR-4731-5p	CLIP-seq
MIRT1057255	hsa-miR-608	CLIP-seq
MIRT2013081	hsa-miR-1184	CLIP-seq
MIRT2013082	hsa-miR-1343	CLIP-seq
MIRT2013083	hsa-miR-203	CLIP-seq
MIRT2013084	hsa-miR-24	CLIP-seq
MIRT2013085	hsa-miR-2681	CLIP-seq
MIRT1057247	hsa-miR-3194-3p	CLIP-seq
MIRT1057248	hsa-miR-342-5p	CLIP-seq
MIRT2013086	hsa-miR-378g	CLIP-seq
MIRT2013087	hsa-miR-4284	CLIP-seq
MIRT2013088	hsa-miR-4418	CLIP-seq
MIRT2013089	hsa-miR-4437	CLIP-seq
MIRT1057251	hsa-miR-4505	CLIP-seq
MIRT1057252	hsa-miR-4651	CLIP-seq
MIRT1057253	hsa-miR-4664-5p	CLIP-seq
MIRT2013090	hsa-miR-4674	CLIP-seq
MIRT1057254	hsa-miR-4731-5p	CLIP-seq
MIRT2013091	hsa-miR-509-3-5p	CLIP-seq
MIRT2013092	hsa-miR-509-5p	CLIP-seq
MIRT1057255	hsa-miR-608	CLIP-seq
MIRT1057244	hsa-miR-1182	CLIP-seq
MIRT2013081	hsa-miR-1184	CLIP-seq
MIRT2013082	hsa-miR-1343	CLIP-seq
MIRT1057246	hsa-miR-193a-5p	CLIP-seq
MIRT2245371	hsa-miR-1976	CLIP-seq
MIRT2013083	hsa-miR-203	CLIP-seq
MIRT2013084	hsa-miR-24	CLIP-seq
MIRT2013085	hsa-miR-2681	CLIP-seq
MIRT1057247	hsa-miR-3194-3p	CLIP-seq
MIRT1057248	hsa-miR-342-5p	CLIP-seq
MIRT2245372	hsa-miR-370	CLIP-seq
MIRT2013086	hsa-miR-378g	CLIP-seq
MIRT2013087	hsa-miR-4284	CLIP-seq
MIRT1057250	hsa-miR-431	CLIP-seq
MIRT2013088	hsa-miR-4418	CLIP-seq
MIRT2013089	hsa-miR-4437	CLIP-seq
MIRT1057251	hsa-miR-4505	CLIP-seq
MIRT1057252	hsa-miR-4651	CLIP-seq
MIRT1057253	hsa-miR-4664-5p	CLIP-seq
MIRT2013090	hsa-miR-4674	CLIP-seq
MIRT1057254	hsa-miR-4731-5p	CLIP-seq
MIRT2013091	hsa-miR-509-3-5p	CLIP-seq
MIRT2013092	hsa-miR-509-5p	CLIP-seq
MIRT1057255	hsa-miR-608	CLIP-seq
MIRT2013081	hsa-miR-1184	CLIP-seq
MIRT2013083	hsa-miR-203	CLIP-seq
MIRT2013084	hsa-miR-24	CLIP-seq
MIRT2013085	hsa-miR-2681	CLIP-seq
MIRT1057248	hsa-miR-342-5p	CLIP-seq
MIRT2013087	hsa-miR-4284	CLIP-seq
MIRT2013088	hsa-miR-4418	CLIP-seq
MIRT1057251	hsa-miR-4505	CLIP-seq
MIRT1057252	hsa-miR-4651	CLIP-seq
MIRT1057253	hsa-miR-4664-5p	CLIP-seq
MIRT1057254	hsa-miR-4731-5p	CLIP-seq
MIRT2013091	hsa-miR-509-3-5p	CLIP-seq
MIRT2013092	hsa-miR-509-5p	CLIP-seq
MIRT1057255	hsa-miR-608	CLIP-seq
MIRT1057244	hsa-miR-1182	CLIP-seq
MIRT1057246	hsa-miR-193a-5p	CLIP-seq
MIRT1057247	hsa-miR-3194-3p	CLIP-seq
MIRT1057250	hsa-miR-431	CLIP-seq
MIRT1057251	hsa-miR-4505	CLIP-seq
MIRT1057254	hsa-miR-4731-5p	CLIP-seq
MIRT2013081	hsa-miR-1184	CLIP-seq
MIRT2013084	hsa-miR-24	CLIP-seq
MIRT2013085	hsa-miR-2681	CLIP-seq
MIRT1057248	hsa-miR-342-5p	CLIP-seq
MIRT2013087	hsa-miR-4284	CLIP-seq
MIRT2013088	hsa-miR-4418	CLIP-seq
MIRT1057251	hsa-miR-4505	CLIP-seq
MIRT1057252	hsa-miR-4651	CLIP-seq
MIRT1057253	hsa-miR-4664-5p	CLIP-seq
MIRT1057254	hsa-miR-4731-5p	CLIP-seq
MIRT2013091	hsa-miR-509-3-5p	CLIP-seq
MIRT2013092	hsa-miR-509-5p	CLIP-seq
MIRT1057255	hsa-miR-608	CLIP-seq
MIRT1057244	hsa-miR-1182	CLIP-seq
MIRT2013081	hsa-miR-1184	CLIP-seq
MIRT1057246	hsa-miR-193a-5p	CLIP-seq
MIRT2013084	hsa-miR-24	CLIP-seq
MIRT2013085	hsa-miR-2681	CLIP-seq
MIRT1057247	hsa-miR-3194-3p	CLIP-seq
MIRT1057248	hsa-miR-342-5p	CLIP-seq
MIRT2013087	hsa-miR-4284	CLIP-seq
MIRT1057250	hsa-miR-431	CLIP-seq
MIRT2013088	hsa-miR-4418	CLIP-seq
MIRT1057251	hsa-miR-4505	CLIP-seq
MIRT1057252	hsa-miR-4651	CLIP-seq
MIRT1057253	hsa-miR-4664-5p	CLIP-seq
MIRT1057254	hsa-miR-4731-5p	CLIP-seq
MIRT2013091	hsa-miR-509-3-5p	CLIP-seq
MIRT2013092	hsa-miR-509-5p	CLIP-seq
MIRT1057255	hsa-miR-608	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005230	Function	Extracellular ligand-gated monoatomic ion channel activity	IEA
GO:0005231	Function	Excitatory extracellular ligand-gated monoatomic ion channel activity	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	21138434
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007210	Process	Serotonin receptor signaling pathway	IDA	17392525
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0009986	Component	Cell surface	IDA	16571125
GO:0015276	Function	Ligand-gated monoatomic ion channel activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IBA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IDA	7565620, 9950429
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IEA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IGI	9950429
GO:0034220	Process	Monoatomic ion transmembrane transport	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0042391	Process	Regulation of membrane potential	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0098662	Process	Inorganic cation transmembrane transport	IDA	17392525
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IDA	9950429
GO:0140227	Process	Serotonin-gated cation-selective signaling pathway	IEA
GO:1902495	Component	Transmembrane transporter complex	IBA
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IBA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IEA
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IGI	9950429
GO:1904602	Component	Serotonin-activated cation-selective channel complex	IPI	16116092

MIM	HGNC	e!Ensembl
604654	5298	ENSG00000149305

O95264

Protein name

5-hydroxytryptamine receptor 3B (5-HT3-B) (5-HT3B) (Serotonin receptor 3B)

Protein function

Forms serotonin (5-hydroxytryptamine/5-HT3)-activated cation-selective channel complexes, which when activated cause fast, depolarizing responses in neurons. {ECO:0000269|PubMed:10521471, ECO:0000269|PubMed:12867984, ECO:0000269|PubMed:17392525,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02931	Neur_chan_LBD	32 → 239	Neurotransmitter-gated ion-channel ligand binding domain	Family
PF02932	Neur_chan_memb	246 → 340	Neurotransmitter-gated ion-channel transmembrane region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain cortex, in the caudate nucleus, the hippocampus, the thalamus and the amygdala. Detected in the kidney and testis as well as in monocytes of the spleen, small and large intestine, uterus, prostate, ovary and plac

Sequence

MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVY
LDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIII
NEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTV
EDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPL
VYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTP
LIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRA
VVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSY
LFMLGIYTITLCSLWALWGGV

Sequence length

441

Interactions

View interactions

	KEGG		Reactome
	Serotonergic synapse Taste transduction		Neurotransmitter receptors and postsynaptic signal transmission

HTR3B (5-hydroxytryptamine receptor 3B)