Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
91768
Gene name Gene Name - the full gene name approved by the HGNC.
Cdk5 and Abl enzyme substrate 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CABLES1
Synonyms (NCBI Gene) Gene synonyms aliases
CABL1, CABLES, HsT2563, IK3-1
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein involved in regulation of the cell cycle through interactions with several cyclin-dependent kinases. One study (PMID: 16177568) reported aberrant splicing of transcripts from this gene which results in removal of the cyclin bin
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022619 hsa-miR-124-3p Microarray 18668037
MIRT051451 hsa-let-7e-5p CLASH 23622248
MIRT041951 hsa-miR-484 CLASH 23622248
MIRT041951 hsa-miR-484 CLASH 23622248
MIRT040768 hsa-miR-18a-3p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
TP53 Unknown 11706030
TP73 Unknown 11706030
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20559324, 23455922, 23602568, 25852190, 28514442, 32707033, 33961781
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IBA
GO:0005829 Component Cytosol IDA 17101133
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609194 25097 ENSG00000134508
Protein
UniProt ID Q8TDN4
Protein name CDK5 and ABL1 enzyme substrate 1 (Interactor with CDK3 1) (Ik3-1)
Protein function Cyclin-dependent kinase binding protein. Enhances cyclin-dependent kinase tyrosine phosphorylation by nonreceptor tyrosine kinases, such as that of CDK5 by activated ABL1, which leads to increased CDK5 activity and is critical for neuronal devel
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00134 Cyclin_N 485 616 Cyclin, N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in breast, pancreas, colon, head and neck (at protein level). Strongly decreased in more than half of cases of atypical endometrial hyperplasia and in more than 90% of endometrial cancers. {ECO:0000269|PubMed:11585773, ECO:00
Sequence
MAAAAAAATTAACSSGSAGTDAAGASGLQQPPPQPQPQPAAAAPAQPPPEPPRKPRMDPR
RRQAALSFLTNISLDGRLPPQDAEWGGGEEGGAAKPGAGGACGARTRFSLLAAAERGGCI
ALAAPGTPAAGLAAGSGPCLPQPSSLPPLIPGGHATVSGPGVARGFASPLGAGRASGEQW
QPPRPAPLAACAQLQLLDGSGAAGQEELEEDDAFISVQVPAAAFLGSGTPGSGSGSRGRL
NSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEE
NAPLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTRNGRIVLISGRRSFCSIFSVLPYRDST
QVGDLKLDGGRQSTGAVSLKEIIGLEGVELGADGKTVSYTQFLLPTNAFGARRNTIDSTS
SFSQFRNLSHRSLSIGRASGTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGKHKRVLIFPS
YMTTVIDYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGLEEPTVAM
AFVYFEKLALKGKLNKQNRKLCAGACVLLAAKIGSDLKKHEVKHLIDKLEEKFRLNRREL
IAFEFPVLVALEFALH
LPEHEVMPHYRRLVQSS
Sequence length 633
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Cyclin E associated events during G1/S transition
Cyclin A:Cdk2-associated events at S phase entry
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or gastroesophageal reflux disease N/A N/A GWAS
Breast Cancer Breast cancer N/A N/A GWAS
Lung adenocarcinoma Lung adenocarcinoma N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinogenesis Inhibit 17982127
Chronobiology Disorders Associate 37555665
Colonic Neoplasms Associate 16177568, 17982127
Colorectal Neoplasms Inhibit 16177568, 17982127
Diabetes Mellitus Type 2 Inhibit 37555665
Growth Disorders Associate 28744006
Insulin Resistance Associate 37555665
Lichen Sclerosus et Atrophicus Associate 21718371
Lung Neoplasms Inhibit 18059193
Lung Neoplasms Associate 24975575