ZNF804A (zinc finger protein 804A)

Gene

• Entrez ID: 91752
• Gene name: Zinc finger protein 804A
• Gene symbol: ZNF804A
• Synonyms (NCBI Gene): C2orf10
• Chromosome: 2
• Chromosome location: 2q32.1
• Summary: The protein encoded by this gene is a zinc finger binding protein. Polymorphisms in this gene, especially rs1344706, are thought to confer increased susceptibility to schizophrenia, bipolar disorder, and heroin addiciton. [provided by RefSeq, Nov 2015]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007068	hsa-miR-137	Luciferase reporter assay	22883350
MIRT007068	hsa-miR-137	Luciferase reporter assay	22883350
MIRT1540371	hsa-miR-101	CLIP-seq
MIRT1540372	hsa-miR-144	CLIP-seq
MIRT1540373	hsa-miR-25	CLIP-seq
MIRT1540374	hsa-miR-32	CLIP-seq
MIRT1540375	hsa-miR-363	CLIP-seq
MIRT1540376	hsa-miR-3646	CLIP-seq
MIRT1540377	hsa-miR-367	CLIP-seq
MIRT1540378	hsa-miR-4317	CLIP-seq
MIRT1540379	hsa-miR-4325	CLIP-seq
MIRT1540380	hsa-miR-4711-5p	CLIP-seq
MIRT1540381	hsa-miR-582-5p	CLIP-seq
MIRT1540382	hsa-miR-600	CLIP-seq
MIRT1540383	hsa-miR-92a	CLIP-seq
MIRT1540384	hsa-miR-92b	CLIP-seq
MIRT1540381	hsa-miR-582-5p	CLIP-seq
MIRT1540371	hsa-miR-101	CLIP-seq
MIRT1540372	hsa-miR-144	CLIP-seq
MIRT1540373	hsa-miR-25	CLIP-seq
MIRT1540374	hsa-miR-32	CLIP-seq
MIRT1540375	hsa-miR-363	CLIP-seq
MIRT1540377	hsa-miR-367	CLIP-seq
MIRT1540378	hsa-miR-4317	CLIP-seq
MIRT1540379	hsa-miR-4325	CLIP-seq
MIRT1540380	hsa-miR-4711-5p	CLIP-seq
MIRT2382292	hsa-miR-4803	CLIP-seq
MIRT1540381	hsa-miR-582-5p	CLIP-seq
MIRT1540382	hsa-miR-600	CLIP-seq
MIRT1540383	hsa-miR-92a	CLIP-seq
MIRT1540384	hsa-miR-92b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	27837918
GO:0005737	Component	Cytoplasm	IDA	27837918
GO:0005886	Component	Plasma membrane	IDA	27837918
GO:0010628	Process	Positive regulation of gene expression	IMP	27837918
GO:0010975	Process	Regulation of neuron projection development	IGI	27837918
GO:0010976	Process	Positive regulation of neuron projection development	IMP	27837918
GO:0030426	Component	Growth cone	IDA	27837918
GO:0043025	Component	Neuronal cell body	IDA	27837918
GO:0043197	Component	Dendritic spine	IDA	27837918
GO:0043198	Component	Dendritic shaft	IDA	27837918
GO:0046872	Function	Metal ion binding	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IDA	27837918
GO:1901588	Component	Dendritic microtubule	IDA	27837918
GO:1902952	Process	Positive regulation of dendritic spine maintenance	IEA

Other IDs

• MIM: 612282
• HGNC: 21711
• e!Ensembl: ENSG00000170396

Protein

• UniProt ID: Q7Z570
• Protein name: Zinc finger protein 804A
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12171	zf-C2H2_jaz	56 → 84	Zinc-finger double-stranded RNA-binding	Family

• Sequence:

  MECYYIVISSTHLSNGHFRNIKGVFRGPLSKNGNKTLDYAEKENTIAKALEDLKANFYCE
  LCDKQYYKHQEFDNHINSYDHAHKQRLKELKQREFARNVASKSRKDERKQEKALQRLHKL
  AELRKETVCAPGSGPMFKSTTVTVRENCNEISQRVVVDSVNNQQDFKYTLIHSEENTKDA
  TTVAEDPESANNYTAKNNQVGDQAQGIHRHKIGFSFAFPKKASVKLESSAAAFSEYSDDA
  SVGKGFSRKSRFVPSACHLQQSSPTDVLLSSEEKTNSFHPPEAMCRDKETVQTQEIKEVS
  SEKDALLLPSFCKFQLQLSSDADNCQNSVPLADQIPLESVVINEDIPVSGNSFELLGNKS
  TVLDMSNDCISVQATTEENVKHNEASTTEVENKNGPETLAPSNTEEVNITIHKKTNFCKR
  QCEPFVPVLNKHRSTVLQWPSEMLVYTTTKPSISYSCNPLCFDFKSTKVNNNLDKNKPDL
  KDLCSQQKQEDICMGPLSDYKDVSTEGLTDYEIGSSKNKCSQVTPLLADDILSSSCDSGK
  NENTGQRYKNISCKIRETEKYNFTKSQIKQDTLDEKYNKIRLKETHEYWFHKSRRKKKRK
  KLCQHHHMEKTKESETRCKMEAENSYTENAGKYLLEPISEKQYLAAEQLLDSHQLLDKRP
  KSESISLSDNEEMCKTWNTEYNTYDTISSKNHCKKNTILLNGQSNATMIHSGKHNLTYSR
  TYCCWKTKMSSCSQDHRSLVLQNDMKHMSQNQAVKRGYNSVMNESERFYRKRRQHSHSYS
  SDESLNRQNHLPEEFLRPPSTSVAPCKPKKKRRRKRGRFHPGFETLELKENTDYPVKDNS
  SLNPLDRLISEDKKEKMKPQEVAKIERNSEQTNQLRNKLSFHPNNLLPSETNGETEHLEM
  ETTSGELSDVSNDPTTSVCVASAPTKEAIDNTLLEHKERSENINLNEKQIPFQVPNIERN
  FRQSQPKSYLCHYELAEALPQGKMNETPTEWLRYNSGILNTQPPLPFKEAHVSGHTFVTA
  EQILAPLALPEQALLIPLENHDKFKNVPCEVYQHILQPNMLANKVKFTFPPAALPPPSTP
  LQPLPLQQSLCSTSVTTIHHTVLQQHAAAAAAAAAAAAAGTFKVLQPHQQFLSQIPALTR
  TSLPQLSVGPVGPRLCPGNQPTFVAPPQMPIIPASVLHPSHLAFPSLPHALFPSLLSPHP
  TVIPLQPLF

• Sequence length: 1209

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800, rs63750198, rs63751109, rs863223312, rs63750710, rs63751615, rs63750206, rs63750781, rs63750899, rs63750691, rs63750217, rs121912965, rs63749939, rs63751194, rs63750693, rs63750540, rs63751221, rs193922370, rs80359596, rs397514632, rs483352909, rs200495564, rs397514684, rs397516436, rs398122386, rs79512956, rs74953290, rs587779001, rs63750677, rs63749837, rs267607816, rs63751715, rs267607819, rs267607815, rs267607822, rs63749906, rs587778883, rs63750472, rs63751012, rs63750715, rs63750580, rs267607706, rs267607709, rs267607710, rs587778894, rs63750749, rs63750483, rs63751015, rs63751153, rs63751094, rs63751118, rs63750316, rs63749981, rs587778906, rs267607821, rs587778908, rs63750020, rs587778909, rs63750713, rs267607825, rs63751592, rs281864936, rs587778913, rs587778914, rs63749795, rs63750855, rs63749916, rs63749923, rs63751472, rs63751689, rs267607832, rs267607837, rs267607836, rs587778923, rs63750028, rs587778928, rs587778929, rs587778930, rs63751277, rs587778933, rs267607842, rs267607843, rs63750192, rs587778934, rs63750193, rs587778937, rs587778938, rs267607845, rs63751244, rs63751393, rs63751460, rs267607849, rs267607853, rs267607856, rs267607850, rs63751657, rs267607854, rs267607852, rs587778942, rs63750309, rs63750587, rs63749863, rs63751486, rs63750016, rs63749868, rs63750375, rs63750035, rs63750604, rs63750386, rs63750150, rs63750486, rs63751428, rs267607866, rs63749986, rs63751594, rs63750152, rs63750850, rs267607867, rs267607868, rs63751632, rs267607871, rs63751892, rs587778956, rs63750469, rs587778958, rs63749792, rs267607875, rs63751255, rs281864938, rs63751202, rs63750726, rs63751310, rs63749900, rs587778964, rs267607879, rs267607878, rs587778966, rs267607883, rs267607887, rs63750061, rs63750663, rs587778968, rs587778971, rs63750809, rs63749867, rs63750864, rs587778972, rs63751275, rs267607718, rs267607722, rs63750769, rs267607717, rs587778973, rs267607716, rs267607720, rs63749995, rs63750859, rs587778975, rs63750114, rs587778976, rs63750603, rs267607889, rs267607723, rs63750561, rs63750499, rs63751642, rs63751022, rs587778981, rs63750971, rs267607898, rs267607906, rs267607903, rs587778989, rs587778992, rs267607894, rs267607901, rs267607892, rs63750437, rs587778997, rs587778998, rs63750005, rs63750641, rs63751421, rs11541859, rs63750266, rs111052004, rs267607726, rs267607727, rs63750453, rs267607734, rs267607735, rs63751665, rs267607736, rs267607732, rs63749816, rs63750539, rs267607739, rs587779006, rs587779008, rs267607745, rs267607742, rs63751595, rs267607743, rs587779010, rs587779012, rs63750057, rs63749818, rs63751124, rs587779014, rs587779015, rs63749820, rs63751302, rs267607750, rs267607751, rs267607749, rs63750891, rs63749959, rs63749804, rs267607765, rs267607760, rs587779021, rs267607759, rs63750515, rs587779023, rs63751021, rs63751480, rs267607772, rs267607773, rs587779024, rs63751653, rs587779027, rs267607767, rs587779029, rs63750706, rs63750385, rs267607774, rs267607778, rs267607780, rs587779034, rs63751711, rs267607784, rs587779035, rs63750823, rs63750822, rs267607787, rs63750303, rs63749839, rs63749827, rs267607789, rs267607790, rs267607791, rs267607786, rs267607771, rs267607795, rs267607794, rs267607788, rs267607799, rs267607801, rs587779045, rs63750034, rs587779047, rs63750216, rs63751707, rs63751598, rs267607803, rs267607777, rs63750144, rs267607805, rs63750547, rs63750489, rs63750993, rs587779054, rs63751259, rs63749926, rs63750796, rs587779058, rs63750745, rs63750582, rs180177084, rs587779866, rs200389141, rs587779950, rs587780104, rs587780183, rs587778536, rs587780683, rs587781554, rs267607712, rs587777627, rs587783057, rs730881734, rs41542214, rs730881273, rs786203456, rs786201990, rs786202767, rs748005072, rs786204317, rs786204318, rs797045117, rs63750549, rs863225383, rs863225384, rs863225373, rs863225376, rs863225377, rs863225378, rs863225379, rs863225380, rs863225381, rs63750059, rs267607823, rs864622457, rs869312767, rs869312753, rs876661059, rs876658915, rs876658923, rs876660860, rs876660822, rs876660458, rs876660214, rs876658657, rs876658247, rs876659226, rs876658821, rs876660589, rs876659068, rs876659681, rs876659608, rs878853794, rs878853778, rs878853780, rs878853785, rs886039423, rs886039424, rs1057517543, rs1057517541, rs756843954, rs1057517617, rs1057517558, rs1057519256, rs1060500689, rs764085979, rs1060500707, rs1060500699, rs1060500706, rs1060500703, rs1064795341, rs1064793607, rs1064794348, rs1064795441, rs1064794373, rs1064793172, rs1064794122, rs1064795515, rs1064794331, rs63750978, rs1114167435, rs1553641362, rs63751448, rs1553648029, rs1553648058, rs587778903, rs1553653237, rs1553664353, rs267607744, rs1553647995, rs1553648047, rs1553653084, rs1553663750, rs1553664436, rs1553488015, rs1553637293, rs63750310, rs63750443, rs63751596, rs1553646681, rs550890395, rs1064796057, rs1553642079, rs1553648023, rs587782087, rs746536721, rs1553653037, rs1248251121, rs1553646602, rs1434898623, rs1553665683, rs1553648068, rs1553645331, rs1553644123, rs1553658246, rs1553651299, rs1553648149, rs1553663159, rs1302248679, rs1553664119, rs1553658009, rs1553665977, rs1416171624, rs1553663834, rs1553664617, rs1553664702, rs1553647969, rs1553648040, rs1437454428, rs1553641273, rs63751101, rs1553646764, rs1553648225, rs1554082118, rs1553648201, rs1553638868, rs1553665866, rs376736188, rs1553642707, rs1553645226, rs1553652883, rs63751435, rs1553653115, rs1553653195, rs63750300, rs1553662622, rs1553658104, rs1553648220, rs1559544064, rs63750584, rs267608083, rs1559551570, rs1559575107, rs1559553501, rs1565986506, rs1559524405, rs1559553492, rs1559554339, rs1559588540, rs1559558071, rs761329565, rs1559521039, rs1559574795, rs1567221417, rs1559578422, rs1481129490, rs1570714352, rs779783209, rs1575376830, rs1575469070, rs1575537843, rs1575620443, rs1575621506, rs587779022, rs1575414904, rs1575449093, rs1575469505, rs1575536254, rs1575537933, rs1575632112, rs1575639851, rs1575441094, rs1575449402, rs267607831, rs2081922847, rs2083403132, rs2085415927, rs2085469647, rs2043913790, rs147542208
Papillary renal carcinoma	Papillary Renal Cell Carcinoma	rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724	22138691
Renal carcinoma	Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney	rs121913668, rs121913670, rs121913243, rs786202724	22138691
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	28991256, 25056061, 29121268, 18677311, 30285260, 30626913, 31374203, 26198764, 29483656, 31268507

Unknown
Disease term	Disease name	Evidence	References	Source
Chromophobe carcinoma	Chromophobe Renal Cell Carcinoma		22138691	ClinVar
Mental depression	Major Depressive Disorder		30626913	ClinVar
Neurodevelopmental Disorders	complex neurodevelopmental disorder			GenCC
Neuroticism	Neuroticism			GWAS
Bipolar Disorder	Bipolar Disorder			GWAS
Anxiety Disorder	Anxiety Disorder			GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus			GWAS
Prostate cancer	Prostate cancer	Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population.		GWAS, CBGDA
Mental Depression	Mental Depression			GWAS
Insomnia	Insomnia			GWAS
Myocardial Infarction	Myocardial Infarction			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Alcoholism	Associate	31294817
Anxiety	Associate	20048749
Apraxias	Associate	24866414
Attention Deficit Disorder with Hyperactivity	Associate	23351715
Attenuated familial adenomatous polyposis	Associate	23155182
Autism Spectrum Disorder	Associate	21915259, 22543975, 24736721, 25905630, 30597088, 30670685
Autistic Disorder	Associate	24866414, 31294817
Behcet Syndrome	Associate	23351715
Bipolar Disorder	Associate	19329560, 20048749, 20368704, 21040459, 21525856, 21915259, 22042765, 22840435, 23155182, 23351715, 24315717, 24625750, 24685285, 25162540, 25905630, 27790829, 28120939, 29257977, 30079586, 30597088
Cognition Disorders	Associate	22373944
Communicable Diseases	Associate	25905630
Dementia	Associate	34321086
Depressive Disorder Major	Associate	25162540
Disease	Associate	24625750
Disruptive Impulse Control and Conduct Disorders	Associate	21525856
Epilepsy	Associate	19329560
Gingival Hemorrhage	Associate	30760334
Heroin Dependence	Associate	31294817
Leukoencephalopathies	Associate	24685285
Lupus Erythematosus Systemic	Associate	28740209
Lupus Nephritis	Associate	28740209
Mental Disorders	Associate	22521361, 30670685
Neuroblastoma	Associate	32626976
Neurologic Manifestations	Associate	24866414
Nuchal Cord	Associate	28600059
Pain Referred	Associate	23155182
Paranoid Disorders	Associate	23155182
Psychotic Disorders	Associate	20048749, 21040459, 21525856, 22042765, 22840435, 23155182, 23351715, 24828433, 25162540, 29257977, 30079586
Pulmonary Atelectasis	Associate	31049583
Schizophrenia	Associate	19329560, 20048749, 20368704, 20664580, 21040459, 21525856, 22042765, 22373944, 22781169, 22840435, 22883350, 23155182, 23351715, 24078172, 24315717, 24447899, 24625750, 24685285, 24736721, 24828433, 25162540, 25905630, 26498712, 27790829, 28120939, 29257977, 30079586, 30597088, 30626913, 31122238, 31294817, 32059228, 32626976
Schizophrenia Disorganized	Associate	32059228
Speech Disorders	Associate	30079586
Syncope	Associate	31049583
Syndactyly	Associate	28600059
Tobacco Use Disorder	Associate	31294817