Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	91752
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger protein 804A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZNF804A
Synonyms (NCBI Gene) Gene synonyms aliases	C2orf10
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q32.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a zinc finger binding protein. Polymorphisms in this gene, especially rs1344706, are thought to confer increased susceptibility to schizophrenia, bipolar disorder, and heroin addiciton. [provided by RefSeq, Nov 2015]

Show/Hide all(31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007068	hsa-miR-137	Luciferase reporter assay	22883350
MIRT007068	hsa-miR-137	Luciferase reporter assay	22883350
MIRT1540371	hsa-miR-101	CLIP-seq
MIRT1540372	hsa-miR-144	CLIP-seq
MIRT1540373	hsa-miR-25	CLIP-seq
MIRT1540374	hsa-miR-32	CLIP-seq
MIRT1540375	hsa-miR-363	CLIP-seq
MIRT1540376	hsa-miR-3646	CLIP-seq
MIRT1540377	hsa-miR-367	CLIP-seq
MIRT1540378	hsa-miR-4317	CLIP-seq
MIRT1540379	hsa-miR-4325	CLIP-seq
MIRT1540380	hsa-miR-4711-5p	CLIP-seq
MIRT1540381	hsa-miR-582-5p	CLIP-seq
MIRT1540382	hsa-miR-600	CLIP-seq
MIRT1540383	hsa-miR-92a	CLIP-seq
MIRT1540384	hsa-miR-92b	CLIP-seq
MIRT1540381	hsa-miR-582-5p	CLIP-seq
MIRT1540371	hsa-miR-101	CLIP-seq
MIRT1540372	hsa-miR-144	CLIP-seq
MIRT1540373	hsa-miR-25	CLIP-seq
MIRT1540374	hsa-miR-32	CLIP-seq
MIRT1540375	hsa-miR-363	CLIP-seq
MIRT1540377	hsa-miR-367	CLIP-seq
MIRT1540378	hsa-miR-4317	CLIP-seq
MIRT1540379	hsa-miR-4325	CLIP-seq
MIRT1540380	hsa-miR-4711-5p	CLIP-seq
MIRT2382292	hsa-miR-4803	CLIP-seq
MIRT1540381	hsa-miR-582-5p	CLIP-seq
MIRT1540382	hsa-miR-600	CLIP-seq
MIRT1540383	hsa-miR-92a	CLIP-seq
MIRT1540384	hsa-miR-92b	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	27837918
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	27837918
GO:0005886	Component	Plasma membrane	IDA	27837918
GO:0008270	Function	Zinc ion binding	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	27837918
GO:0010975	Process	Regulation of neuron projection development	IGI	27837918
GO:0010976	Process	Positive regulation of neuron projection development	IMP	27837918
GO:0030424	Component	Axon	IEA
GO:0030426	Component	Growth cone	IDA	27837918
GO:0043025	Component	Neuronal cell body	IDA	27837918
GO:0043025	Component	Neuronal cell body	IEA
GO:0043197	Component	Dendritic spine	IDA	27837918
GO:0043197	Component	Dendritic spine	IEA
GO:0043198	Component	Dendritic shaft	IDA	27837918
GO:0043198	Component	Dendritic shaft	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IDA	27837918
GO:0098794	Component	Postsynapse	IEA
GO:1901588	Component	Dendritic microtubule	IDA	27837918
GO:1902952	Process	Positive regulation of dendritic spine maintenance	IEA

MIM	HGNC	e!Ensembl
612282	21711	ENSG00000170396

Protein

UniProt ID

Q7Z570

Protein name

Zinc finger protein 804A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12171	zf-C2H2_jaz	56 → 84	Zinc-finger double-stranded RNA-binding	Family

Sequence

MECYYIVISSTHLSNGHFRNIKGVFRGPLSKNGNKTLDYAEKENTIAKALEDLKANFYCE
LCDKQYYKHQEFDNHINSYDHAHKQRLKELKQREFARNVASKSRKDERKQEKALQRLHKL
AELRKETVCAPGSGPMFKSTTVTVRENCNEISQRVVVDSVNNQQDFKYTLIHSEENTKDA
TTVAEDPESANNYTAKNNQVGDQAQGIHRHKIGFSFAFPKKASVKLESSAAAFSEYSDDA
SVGKGFSRKSRFVPSACHLQQSSPTDVLLSSEEKTNSFHPPEAMCRDKETVQTQEIKEVS
SEKDALLLPSFCKFQLQLSSDADNCQNSVPLADQIPLESVVINEDIPVSGNSFELLGNKS
TVLDMSNDCISVQATTEENVKHNEASTTEVENKNGPETLAPSNTEEVNITIHKKTNFCKR
QCEPFVPVLNKHRSTVLQWPSEMLVYTTTKPSISYSCNPLCFDFKSTKVNNNLDKNKPDL
KDLCSQQKQEDICMGPLSDYKDVSTEGLTDYEIGSSKNKCSQVTPLLADDILSSSCDSGK
NENTGQRYKNISCKIRETEKYNFTKSQIKQDTLDEKYNKIRLKETHEYWFHKSRRKKKRK
KLCQHHHMEKTKESETRCKMEAENSYTENAGKYLLEPISEKQYLAAEQLLDSHQLLDKRP
KSESISLSDNEEMCKTWNTEYNTYDTISSKNHCKKNTILLNGQSNATMIHSGKHNLTYSR
TYCCWKTKMSSCSQDHRSLVLQNDMKHMSQNQAVKRGYNSVMNESERFYRKRRQHSHSYS
SDESLNRQNHLPEEFLRPPSTSVAPCKPKKKRRRKRGRFHPGFETLELKENTDYPVKDNS
SLNPLDRLISEDKKEKMKPQEVAKIERNSEQTNQLRNKLSFHPNNLLPSETNGETEHLEM
ETTSGELSDVSNDPTTSVCVASAPTKEAIDNTLLEHKERSENINLNEKQIPFQVPNIERN
FRQSQPKSYLCHYELAEALPQGKMNETPTEWLRYNSGILNTQPPLPFKEAHVSGHTFVTA
EQILAPLALPEQALLIPLENHDKFKNVPCEVYQHILQPNMLANKVKFTFPPAALPPPSTP
LQPLPLQQSLCSTSVTTIHHTVLQQHAAAAAAAAAAAAAGTFKVLQPHQQFLSQIPALTR
TSLPQLSVGPVGPRLCPGNQPTFVAPPQMPIIPASVLHPSHLAFPSLPHALFPSLLSPHP
TVIPLQPLF

Sequence length

1209

Interactions

View interactions

Show/Hide Unknown Diseases (10)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Anxiety Disorder	Anxiety	N/A	N/A	GWAS
Bipolar Disorder	Bipolar disorder	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Mental Depression	Major depressive disorder	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS
Neurodevelopmental Disorders	complex neurodevelopmental disorder	N/A	N/A	GenCC
Neuroticism	Neuroticism	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS

Show/Hide Text Mining Associations (35)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alcoholism	Associate	31294817
Anxiety	Associate	20048749
Apraxias	Associate	24866414
Attention Deficit Disorder with Hyperactivity	Associate	23351715
Attenuated familial adenomatous polyposis	Associate	23155182
Autism Spectrum Disorder	Associate	21915259, 22543975, 24736721, 25905630, 30597088, 30670685
Autistic Disorder	Associate	24866414, 31294817
Behcet Syndrome	Associate	23351715
Bipolar Disorder	Associate	19329560, 20048749, 20368704, 21040459, 21525856, 21915259, 22042765, 22840435, 23155182, 23351715, 24315717, 24625750, 24685285, 25162540, 25905630 View all (5 more)
Cognition Disorders	Associate	22373944
Communicable Diseases	Associate	25905630
Dementia	Associate	34321086
Depressive Disorder Major	Associate	25162540
Disease	Associate	24625750
Disruptive Impulse Control and Conduct Disorders	Associate	21525856
Epilepsy	Associate	19329560
Gingival Hemorrhage	Associate	30760334
Heroin Dependence	Associate	31294817
Leukoencephalopathies	Associate	24685285
Lupus Erythematosus Systemic	Associate	28740209
Lupus Nephritis	Associate	28740209
Mental Disorders	Associate	22521361, 30670685
Neuroblastoma	Associate	32626976
Neurologic Manifestations	Associate	24866414
Nuchal Cord	Associate	28600059
Pain Referred	Associate	23155182
Paranoid Disorders	Associate	23155182
Psychotic Disorders	Associate	20048749, 21040459, 21525856, 22042765, 22840435, 23155182, 23351715, 24828433, 25162540, 29257977, 30079586
Pulmonary Atelectasis	Associate	31049583
Schizophrenia	Associate	19329560, 20048749, 20368704, 20664580, 21040459, 21525856, 22042765, 22373944, 22781169, 22840435, 22883350, 23155182, 23351715, 24078172, 24315717 View all (18 more)
Schizophrenia Disorganized	Associate	32059228
Speech Disorders	Associate	30079586
Syncope	Associate	31049583
Syndactyly	Associate	28600059
Tobacco Use Disorder	Associate	31294817

ZNF804A (zinc finger protein 804A)