Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9173
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 1 receptor like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL1RL1
Synonyms (NCBI Gene) Gene synonyms aliases	DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q12.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gen

Show/Hide all(110)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029172	hsa-miR-26b-5p	Microarray	19088304
MIRT1064418	hsa-miR-149	CLIP-seq
MIRT1064419	hsa-miR-3064-5p	CLIP-seq
MIRT1064420	hsa-miR-3065-5p	CLIP-seq
MIRT1064421	hsa-miR-3126-3p	CLIP-seq
MIRT1064422	hsa-miR-3164	CLIP-seq
MIRT1064423	hsa-miR-4687-3p	CLIP-seq
MIRT1064424	hsa-miR-4704-3p	CLIP-seq
MIRT1064425	hsa-miR-4794	CLIP-seq
MIRT1064426	hsa-miR-505	CLIP-seq
MIRT1064427	hsa-miR-617	CLIP-seq
MIRT1064428	hsa-miR-4434	CLIP-seq
MIRT1064429	hsa-miR-4516	CLIP-seq
MIRT2015304	hsa-miR-1237	CLIP-seq
MIRT2015305	hsa-miR-143	CLIP-seq
MIRT2015306	hsa-miR-193a-5p	CLIP-seq
MIRT2015307	hsa-miR-23a	CLIP-seq
MIRT2015308	hsa-miR-23b	CLIP-seq
MIRT2015309	hsa-miR-23c	CLIP-seq
MIRT2015310	hsa-miR-2964a-5p	CLIP-seq
MIRT2015311	hsa-miR-298	CLIP-seq
MIRT2015312	hsa-miR-3074-5p	CLIP-seq
MIRT2015313	hsa-miR-3152-5p	CLIP-seq
MIRT2015314	hsa-miR-3158-5p	CLIP-seq
MIRT2015315	hsa-miR-4297	CLIP-seq
MIRT2015316	hsa-miR-4326	CLIP-seq
MIRT2015317	hsa-miR-4426	CLIP-seq
MIRT2015318	hsa-miR-4647	CLIP-seq
MIRT2015319	hsa-miR-4659a-5p	CLIP-seq
MIRT2015320	hsa-miR-4659b-5p	CLIP-seq
MIRT2015321	hsa-miR-4662b	CLIP-seq
MIRT2015322	hsa-miR-4677-3p	CLIP-seq
MIRT2015323	hsa-miR-4722-3p	CLIP-seq
MIRT2015324	hsa-miR-4727-5p	CLIP-seq
MIRT2015325	hsa-miR-4769-3p	CLIP-seq
MIRT2015326	hsa-miR-4770	CLIP-seq
MIRT2015327	hsa-miR-4774-3p	CLIP-seq
MIRT2015328	hsa-miR-584	CLIP-seq
MIRT2015329	hsa-miR-596	CLIP-seq
MIRT2015330	hsa-miR-7	CLIP-seq
MIRT2247656	hsa-miR-1266	CLIP-seq
MIRT2247657	hsa-miR-3074-3p	CLIP-seq
MIRT2247658	hsa-miR-3130-5p	CLIP-seq
MIRT2247659	hsa-miR-3664-3p	CLIP-seq
MIRT2247660	hsa-miR-4419a	CLIP-seq
MIRT2247661	hsa-miR-4456	CLIP-seq
MIRT2247662	hsa-miR-4482	CLIP-seq
MIRT2247663	hsa-miR-4510	CLIP-seq
MIRT2247664	hsa-miR-4518	CLIP-seq
MIRT2247665	hsa-miR-4678	CLIP-seq
MIRT2247666	hsa-miR-541	CLIP-seq
MIRT2247667	hsa-miR-654-5p	CLIP-seq
MIRT2451734	hsa-miR-148a	CLIP-seq
MIRT2451735	hsa-miR-148b	CLIP-seq
MIRT2451736	hsa-miR-152	CLIP-seq
MIRT2451737	hsa-miR-1909	CLIP-seq
MIRT2451738	hsa-miR-342-3p	CLIP-seq
MIRT2451739	hsa-miR-3945	CLIP-seq
MIRT2451740	hsa-miR-4276	CLIP-seq
MIRT2451741	hsa-miR-4688	CLIP-seq
MIRT2551063	hsa-miR-124	CLIP-seq
MIRT2551064	hsa-miR-142-5p	CLIP-seq
MIRT1064418	hsa-miR-149	CLIP-seq
MIRT2551065	hsa-miR-1825	CLIP-seq
MIRT2551066	hsa-miR-1972	CLIP-seq
MIRT2551067	hsa-miR-221	CLIP-seq
MIRT2551068	hsa-miR-222	CLIP-seq
MIRT1064419	hsa-miR-3064-5p	CLIP-seq
MIRT1064421	hsa-miR-3126-3p	CLIP-seq
MIRT2551069	hsa-miR-3134	CLIP-seq
MIRT2551070	hsa-miR-3183	CLIP-seq
MIRT2551071	hsa-miR-331-5p	CLIP-seq
MIRT2551072	hsa-miR-3659	CLIP-seq
MIRT2551073	hsa-miR-3688-5p	CLIP-seq
MIRT2551074	hsa-miR-3714	CLIP-seq
MIRT2551075	hsa-miR-3910	CLIP-seq
MIRT2551076	hsa-miR-4255	CLIP-seq
MIRT2551077	hsa-miR-4266	CLIP-seq
MIRT2451740	hsa-miR-4276	CLIP-seq
MIRT2551078	hsa-miR-4302	CLIP-seq
MIRT2551079	hsa-miR-4305	CLIP-seq
MIRT2551080	hsa-miR-431	CLIP-seq
MIRT2247660	hsa-miR-4419a	CLIP-seq
MIRT2551081	hsa-miR-4501	CLIP-seq
MIRT2247663	hsa-miR-4510	CLIP-seq
MIRT2551082	hsa-miR-4534	CLIP-seq
MIRT2551083	hsa-miR-4658	CLIP-seq
MIRT1064423	hsa-miR-4687-3p	CLIP-seq
MIRT2551084	hsa-miR-4695-5p	CLIP-seq
MIRT2551085	hsa-miR-4723-3p	CLIP-seq
MIRT2551086	hsa-miR-4777-5p	CLIP-seq
MIRT2551087	hsa-miR-4779	CLIP-seq
MIRT1064425	hsa-miR-4794	CLIP-seq
MIRT2551088	hsa-miR-506	CLIP-seq
MIRT2551089	hsa-miR-511	CLIP-seq
MIRT2551090	hsa-miR-518d-5p	CLIP-seq
MIRT2551091	hsa-miR-519b-5p	CLIP-seq
MIRT2551092	hsa-miR-519c-5p	CLIP-seq
MIRT2551093	hsa-miR-520c-5p	CLIP-seq
MIRT2551094	hsa-miR-526a	CLIP-seq
MIRT2551095	hsa-miR-548v	CLIP-seq
MIRT2551096	hsa-miR-561	CLIP-seq
MIRT2551097	hsa-miR-570	CLIP-seq
MIRT2551098	hsa-miR-574-5p	CLIP-seq
MIRT1064427	hsa-miR-617	CLIP-seq
MIRT2551099	hsa-miR-642b	CLIP-seq
MIRT2551100	hsa-miR-644	CLIP-seq
MIRT2551101	hsa-miR-646	CLIP-seq
MIRT2551102	hsa-miR-890	CLIP-seq
MIRT2551101	hsa-miR-646	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
GATA1	Unknown	22865859
GATA2	Unknown	22865859

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002113	Function	Interleukin-33 binding	IBA	21873635
GO:0002114	Function	Interleukin-33 receptor activity	IBA	21873635
GO:0002826	Process	Negative regulation of T-helper 1 type immune response	IEA
GO:0004896	Function	Cytokine receptor activity	TAS	10191101
GO:0004908	Function	Interleukin-1 receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	8621446, 16286016, 25416956
GO:0005576	Component	Extracellular region	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	IDA
GO:0006955	Process	Immune response	NAS	10527832
GO:0007165	Process	Signal transduction	TAS	1482686
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0032689	Process	Negative regulation of interferon-gamma production	IEA
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032754	Process	Positive regulation of interleukin-5 production	IEA
GO:0038172	Process	Interleukin-33-mediated signaling pathway	TAS
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0050135	Function	NAD(P)+ nucleosidase activity	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0061809	Function	NAD+ nucleotidase, cyclic ADP-ribose generating	IEA

MIM	HGNC	e!Ensembl
601203	5998	ENSG00000115602

Protein

UniProt ID

Q01638

Protein name

Interleukin-1 receptor-like 1 (EC 3.2.2.6) (Protein ST2)

Protein function

Receptor for interleukin-33 (IL-33) which plays crucial roles in innate and adaptive immunity, contributing to tissue homeostasis and responses to environmental stresses together with coreceptor IL1RAP (PubMed:35238669). Its stimulation recruits

PDB

4KC3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07679	I-set	18 → 104	Immunoglobulin I-set domain	Domain
PF01582	TIR	379 → 556	TIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. Isoform A is prevalently expressed in the lung, testis, placenta, stomach and colon. Isoform B is more abundant in the brain, kidney and t

Sequence

MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQ
ERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYS
TVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYT
CKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFG
KGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQ
YDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLL
WRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIY
GRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILI
EMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSK
IPRKASSLTPLAAQKQ

Sequence length

556

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction		PIP3 activates AKT signaling PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Interleukin-33 signaling

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	28067908

Show/Hide Unknown Diseases (9)

Disease term	Disease name	References	Source
Unknown
Asthma	Asthma, Childhood asthma	27130862, 24241537, 21804549, 23028483, 20860503, 30552067, 31619474, 24388013, 30929738, 27472835, 29785011, 19198610, 31036433, 29273806, 21150878, 30578877 View all (1 more)	ClinVar, GWAS
Crohn disease	Crohn Disease	28067908	ClinVar
Leprosy	Leprosy	25642632	ClinVar, GWAS
Eczema	Eczema		GWAS
Allergic Sensitization	Allergic Sensitization		GWAS
Nasal polyposis	Nasal polyposis		GWAS
Dermatitis	Dermatitis		GWAS
Crohn Disease	Crohn Disease		GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease		GWAS

Show/Hide Text Mining Associations (52)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	30541599
Asthma	Associate	19852851, 19910030, 20860503, 21150878, 22574108, 22694930, 23028483, 23541324, 25091434, 27026044, 27699235, 29378629, 29519908, 30373671, 31066119 View all (9 more)
Asthma	Stimulate	35986608
Atherosclerosis	Associate	24107076
Behcet Syndrome	Associate	33859633
Breast Neoplasms	Associate	18542066, 23497279
Bronchiolitis	Associate	22574108, 34741482
Carcinoma Hepatocellular	Associate	33062675, 8659516
Carcinoma Renal Cell	Associate	34058568
Carcinoma Squamous Cell	Associate	33717076
Cardiomyopathy Dilated	Associate	38460409
Cardiovascular Diseases	Associate	28121058, 33355808
Carotid Stenosis	Associate	27223112
CD59 Deficiency	Associate	34373564
Celiac Disease	Associate	26859134
Colitis Ulcerative	Associate	28860510
Coronary Artery Disease	Associate	24075188, 35457109
Crohn Disease	Associate	23634226
Dermatitis	Associate	32277847
Dermatitis Atopic	Associate	20625511, 36142206
Dermatitis Atopic 1	Associate	33453290
Dermatitis Atopic 3	Associate	30923181
Diabetes Gestational	Associate	35370940
Diabetic Nephropathies	Associate	11499563
Eczema	Associate	31213409
Essential Hypertension	Associate	28121058
Graft vs Host Disease	Associate	31455667
Hepatitis B Chronic	Associate	8659516
Hypereosinophilic Syndrome	Associate	32324168
Ige Responsiveness Atopic	Associate	19852851, 30923181
Infections	Associate	31455667
Inflammation	Associate	20625511, 22574108, 23634226, 25091434, 25676576, 27699235, 34964571
Inflammation	Stimulate	30541599
Inflammatory Bowel Diseases	Associate	23634226
Leprosy	Associate	34879060
Leukemia	Associate	30742053
Leukemia Myeloid Acute	Associate	33324412
Lung Diseases	Associate	27281349
Macular Degeneration	Associate	32871771
Mast Cell Activation Disorders	Associate	35008966
Myotonic Dystrophy	Associate	39529136
Neoplasms	Associate	31659258, 33717076, 35409061, 36504430
Osteophyte	Stimulate	35008966
Periodontitis	Associate	36947565
Peritonitis	Stimulate	31659258
Prostatic Neoplasms	Associate	36824501
Pulmonary Disease Chronic Obstructive	Associate	39525518
Rhinitis	Associate	32277847
Rhinitis Allergic	Associate	35035826, 36310516, 37206297
Status Asthmaticus	Associate	27699235, 28262704, 31066119, 32324168, 36076228
Stomach Neoplasms	Stimulate	31659258
Vasculitis	Associate	34373564

IL1RL1 (interleukin 1 receptor like 1)