Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9173
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 1 receptor like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL1RL1
Synonyms (NCBI Gene) Gene synonyms aliases
DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q12.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gen
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029172 hsa-miR-26b-5p Microarray 19088304
MIRT1064418 hsa-miR-149 CLIP-seq
MIRT1064419 hsa-miR-3064-5p CLIP-seq
MIRT1064420 hsa-miR-3065-5p CLIP-seq
MIRT1064421 hsa-miR-3126-3p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
GATA1 Unknown 22865859
GATA2 Unknown 22865859
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002113 Function Interleukin-33 binding IBA
GO:0002113 Function Interleukin-33 binding IEA
GO:0002114 Function Interleukin-33 receptor activity IDA 16286016
GO:0002826 Process Negative regulation of T-helper 1 type immune response IEA
GO:0004896 Function Cytokine receptor activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601203 5998 ENSG00000115602
Protein
UniProt ID Q01638
Protein name Interleukin-1 receptor-like 1 (EC 3.2.2.6) (Protein ST2)
Protein function Receptor for interleukin-33 (IL-33) which plays crucial roles in innate and adaptive immunity, contributing to tissue homeostasis and responses to environmental stresses together with coreceptor IL1RAP (PubMed:35238669). Its stimulation recruits
PDB 4KC3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07679 I-set 18 104 Immunoglobulin I-set domain Domain
PF01582 TIR 379 556 TIR domain Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. Isoform A is prevalently expressed in the lung, testis, placenta, stomach and colon. Isoform B is more abundant in the brain, kidney and t
Sequence
MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQ
ERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTI
YKKQSDCNVPDYLMYS
TVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYT
CKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFG
KGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQ
YDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLL
WRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIY
GRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILI
EMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSK
IPRKASSLTPLAAQKQ
Sequence length 556
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction   PIP3 activates AKT signaling
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Interleukin-33 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Allergic Sensitization Allergic sensitization N/A N/A GWAS
Asthma Asthma (adult onset), Age of onset of childhood onset asthma, Asthma in any disease, Asthma (moderate or severe), Asthma (time to onset), Asthma onset (childhood vs adult), Asthma (age of onset), Asthma, Asthma (childhood onset), Nonatopic asthma, Atopic asthma, Pediatric asthma N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 30541599
Asthma Associate 19852851, 19910030, 20860503, 21150878, 22574108, 22694930, 23028483, 23541324, 25091434, 27026044, 27699235, 29378629, 29519908, 30373671, 31066119
View all (9 more)
Asthma Stimulate 35986608
Atherosclerosis Associate 24107076
Behcet Syndrome Associate 33859633
Breast Neoplasms Associate 18542066, 23497279
Bronchiolitis Associate 22574108, 34741482
Carcinoma Hepatocellular Associate 33062675, 8659516
Carcinoma Renal Cell Associate 34058568
Carcinoma Squamous Cell Associate 33717076