Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9167
Gene name Gene Name - the full gene name approved by the HGNC.
Cytochrome c oxidase subunit 7A2 like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
COX7A2L
Synonyms (NCBI Gene) Gene synonyms aliases
COX7AR, COX7RP, EB1, SCAF1, SCAFI, SIG81
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p21
Summary Summary of gene provided in NCBI Entrez Gene.
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochond
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029500 hsa-miR-26b-5p Microarray 19088304
MIRT042835 hsa-miR-324-3p CLASH 23622248
MIRT616513 hsa-miR-6835-3p HITS-CLIP 23824327
MIRT616512 hsa-miR-29a-3p HITS-CLIP 23824327
MIRT616511 hsa-miR-29b-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004129 Function Cytochrome-c oxidase activity TAS 9418891
GO:0005730 Component Nucleolus IDA
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IDA 27545886
GO:0005739 Component Mitochondrion IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605771 2289 ENSG00000115944
Protein
UniProt ID O14548
Protein name Cytochrome c oxidase subunit 7A2-like, mitochondrial (Cytochrome c oxidase subunit 7A-related protein) (COX7a-related protein) (Cytochrome c oxidase subunit VIIa-related protein) (EB1) (Supercomplex assembly factor 1)
Protein function Assembly factor that mediates the formation of some mitochondrial respiratory supercomplexes (respirasomes), thereby promoting oxidative phosphorylation and energy metabolism (PubMed:27545886, PubMed:30428348, PubMed:33727070, PubMed:36198313).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02238 COX7a 58 110 Cytochrome c oxidase subunit VII Family
Sequence
MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKV
PELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQ
PKNK
Sequence length 114
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy
  TP53 Regulates Metabolic Genes
Respiratory electron transport
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Stimulate 31511525
Hypoxia Stimulate 31511525
Hypoxia Brain Associate 31511525
Leigh Disease Associate 11156535
Leigh syndrome French Canadian type Associate 11156535
Neoplasms Associate 31511525
Prostate cancer familial Associate 31511525