Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
91647
Gene name Gene Name - the full gene name approved by the HGNC.
ATP synthase mitochondrial F1 complex assembly factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ATPAF2
Synonyms (NCBI Gene) Gene synonyms aliases
ATP12, ATP12p, LP3663, MC5DN1
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 alpha subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly.
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104894554 A>C,T Pathogenic Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs746446116 A>G Likely-pathogenic Coding sequence variant, intron variant, missense variant, non coding transcript variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT044400 hsa-miR-320a CLASH 23622248
MIRT810261 hsa-miR-224 CLIP-seq
MIRT810262 hsa-miR-3614-5p CLIP-seq
MIRT810263 hsa-miR-759 CLIP-seq
MIRT810261 hsa-miR-224 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 11410595, 21516116, 25416956, 25910212, 27499296, 28514442, 28719601, 29892012, 31515488, 32296183, 33961781
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608918 18802 ENSG00000171953
Protein
UniProt ID Q8N5M1
Protein name ATP synthase mitochondrial F1 complex assembly factor 2 (ATP12 homolog)
Protein function Plays a role in the assembly of the F1 component of the mitochondrial ATP synthase (ATPase).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07542 ATP12 47 166 ATP12 chaperone protein Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:11410595}.
Sequence
MWRSCLRLRDGGRRLLNRPAGGPSASMSPGPTIPSPARAYAPPTERKRFYQNVSITQGEG
GFEINLDHRKLKTPQAKLFTVPSEALAIAVATEWDSQQDTIKYYTMHLTTLCNTSLDNPT
QRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAE
KRYGVEISSSTSIM
GPSIPAKTREVLVSHLASYNTWALQGIEFVAAQLKSMVLTLGLIDLRLTVEQAVLLSRLE
EEYQIQKWGNIEWAHDYELQELRARTAAGTLFIHLCSESTTVKHKLLKE
Sequence length 289
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Mitochondrial Complex Deficiency mitochondrial complex v (atp synthase) deficiency, nuclear type 1 rs104894554 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Microcephaly microcephaly N/A N/A ClinVar
Mitochondrial Diseases mitochondrial disease N/A N/A GenCC
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Dementia Associate 20167577
Leigh Syndrome due to Mitochondrial Complex V Deficiency Associate 14757859
Mitochondrial Diseases Associate 14757859