Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	91582
Gene name	Ribosomal protein S19 binding protein 1
Gene symbol	RPS19BP1
Synonyms (NCBI Gene)	AROSS19BP
Chromosome	22
Chromosome location	22q13.1

Show/Hide all (43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025810	hsa-miR-7-5p	Microarray	19073608
MIRT1317744	hsa-miR-1180	CLIP-seq
MIRT1317745	hsa-miR-3194-3p	CLIP-seq
MIRT1317746	hsa-miR-3665	CLIP-seq
MIRT1317747	hsa-miR-412	CLIP-seq
MIRT1317748	hsa-miR-4290	CLIP-seq
MIRT1317749	hsa-miR-4493	CLIP-seq
MIRT1317750	hsa-miR-4664-3p	CLIP-seq
MIRT1317751	hsa-miR-4736	CLIP-seq
MIRT1317752	hsa-miR-4757-5p	CLIP-seq
MIRT1317753	hsa-miR-764	CLIP-seq
MIRT2094429	hsa-miR-4686	CLIP-seq
MIRT1317744	hsa-miR-1180	CLIP-seq
MIRT2318931	hsa-miR-2355-5p	CLIP-seq
MIRT1317747	hsa-miR-412	CLIP-seq
MIRT1317748	hsa-miR-4290	CLIP-seq
MIRT1317749	hsa-miR-4493	CLIP-seq
MIRT1317752	hsa-miR-4757-5p	CLIP-seq
MIRT2318932	hsa-miR-617	CLIP-seq
MIRT1317744	hsa-miR-1180	CLIP-seq
MIRT2614627	hsa-miR-1913	CLIP-seq
MIRT1317745	hsa-miR-3194-3p	CLIP-seq
MIRT2614628	hsa-miR-324-3p	CLIP-seq
MIRT1317746	hsa-miR-3665	CLIP-seq
MIRT2614629	hsa-miR-4267	CLIP-seq
MIRT2614630	hsa-miR-4650-5p	CLIP-seq
MIRT1317750	hsa-miR-4664-3p	CLIP-seq
MIRT1317751	hsa-miR-4736	CLIP-seq
MIRT2614631	hsa-miR-4786-3p	CLIP-seq
MIRT2614632	hsa-miR-671-5p	CLIP-seq
MIRT1317753	hsa-miR-764	CLIP-seq
MIRT1317744	hsa-miR-1180	CLIP-seq
MIRT2614627	hsa-miR-1913	CLIP-seq
MIRT1317745	hsa-miR-3194-3p	CLIP-seq
MIRT2614628	hsa-miR-324-3p	CLIP-seq
MIRT1317746	hsa-miR-3665	CLIP-seq
MIRT2614629	hsa-miR-4267	CLIP-seq
MIRT2614630	hsa-miR-4650-5p	CLIP-seq
MIRT1317750	hsa-miR-4664-3p	CLIP-seq
MIRT1317751	hsa-miR-4736	CLIP-seq
MIRT2614631	hsa-miR-4786-3p	CLIP-seq
MIRT2614632	hsa-miR-671-5p	CLIP-seq
MIRT1317753	hsa-miR-764	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	17964266, 24681097, 25416956, 32296183, 33961781, 36361557
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	ISS	16289379
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005730	Component	Nucleolus	ISS	16289379
GO:0005829	Component	Cytosol	IDA
GO:0019899	Function	Enzyme binding	IBA
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0032040	Component	Small-subunit processome	IDA	34516797
GO:0042274	Process	Ribosomal small subunit biogenesis	IDA	34516797

MIM	HGNC	e!Ensembl
610225	28749	ENSG00000187051

Q86WX3

Protein name

Active regulator of SIRT1 (40S ribosomal protein S19-binding protein 1) (RPS19-binding protein 1) (S19BP)

Protein function

Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associat

PDB

7MQA , 8BBK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15684	AROS	23 → 134	Active regulator of SIRT1, or 40S ribosomal protein S19-binding 1	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed (at protein level). {ECO:0000269|PubMed:17964266}.

Sequence

MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSAL
DEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTV
FTEEDFQKFQQEYFGS

Sequence length

136

Interactions

View interactions

	Reactome
			Regulation of HSF1-mediated heat shock response

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	26339164	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Noncirrhotic Portal Hypertension	Stimulate	26339164	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	24258275, 26339164	★★★★★ ★☆☆☆☆ Found in Text Mining only

RPS19BP1 (ribosomal protein S19 binding protein 1)