Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9158
Gene name Gene Name - the full gene name approved by the HGNC.	FGF1 intracellular binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FIBP
Synonyms (NCBI Gene) Gene synonyms aliases	FGFIBP, FIBP-1, TROFAS
Disease Acronyms (UniProt) Disease acronyms from UniProt database	TROFAS
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.1
Summary Summary of gene provided in NCBI Entrez Gene.	Acidic fibroblast growth factor is mitogenic for a variety of different cell types and acts by stimulating mitogenesis or inducing morphological changes and differentiation. The FIBP protein is an intracellular protein that binds selectively to acidic fib

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs786204849	G>A	Pathogenic, likely-pathogenic	Stop gained, non coding transcript variant, coding sequence variant
rs886037928	->TTA	Pathogenic	Inframe indel, non coding transcript variant, coding sequence variant, 5 prime UTR variant

Show/Hide all(26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044999	hsa-miR-186-5p	CLASH	23622248
MIRT043668	hsa-miR-342-3p	CLASH	23622248
MIRT1995573	hsa-miR-4733-3p	CLIP-seq
MIRT1995574	hsa-miR-764	CLIP-seq
MIRT2229543	hsa-miR-3907	CLIP-seq
MIRT2229544	hsa-miR-3919	CLIP-seq
MIRT2229545	hsa-miR-4252	CLIP-seq
MIRT2229546	hsa-miR-4269	CLIP-seq
MIRT2229547	hsa-miR-4643	CLIP-seq
MIRT2229548	hsa-miR-466	CLIP-seq
MIRT1995573	hsa-miR-4733-3p	CLIP-seq
MIRT2229549	hsa-miR-4756-3p	CLIP-seq
MIRT2229550	hsa-miR-4789-3p	CLIP-seq
MIRT1995574	hsa-miR-764	CLIP-seq
MIRT2229551	hsa-miR-891b	CLIP-seq
MIRT2533523	hsa-miR-1203	CLIP-seq
MIRT2533524	hsa-miR-3130-3p	CLIP-seq
MIRT2533525	hsa-miR-3131	CLIP-seq
MIRT2229546	hsa-miR-4269	CLIP-seq
MIRT2533526	hsa-miR-4286	CLIP-seq
MIRT2533527	hsa-miR-4707-5p	CLIP-seq
MIRT2533528	hsa-miR-4751	CLIP-seq
MIRT2533529	hsa-miR-4793-3p	CLIP-seq
MIRT2533530	hsa-miR-515-5p	CLIP-seq
MIRT2533531	hsa-miR-611	CLIP-seq
MIRT2229551	hsa-miR-891b	CLIP-seq

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	9806903
GO:0005739	Component	Mitochondrion	TAS	9806903
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	TAS	9806903
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IDA	9806903
GO:0016607	Component	Nuclear speck	IDA
GO:0017134	Function	Fibroblast growth factor binding	IBA	21873635
GO:0017134	Function	Fibroblast growth factor binding	IPI	9806903
GO:0070527	Process	Platelet aggregation	HMP	23382103

MIM	HGNC	e!Ensembl
608296	3705	ENSG00000172500

Protein

UniProt ID

O43427

Protein name

Acidic fibroblast growth factor intracellular-binding protein (aFGF intracellular-binding protein) (FGF-1 intracellular-binding protein)

Protein function

May be involved in mitogenic function of FGF1. May mediate with IER2 FGF-signaling in the establishment of laterality in the embryo (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05427	FIBP	3 → 363	Acidic fibroblast growth factor binding (FIBP)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart, skeletal muscle and pancreas. Expressed at lower levels in brain. Also found in placenta, liver and kidney.

Sequence

MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHY
RTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDL
DDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFA
NNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVGEAPTDPDSQMDDMDMDLDKEFLQD
LKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVR
DLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLR
LYHD

Sequence length

364

Interactions

View interactions

Show/Hide Causal Diseases (6)

Disease term	Disease name	dbSNP ID	References
Causal
Congenital ocular coloboma	Congenital ocular coloboma (disorder)	rs587778875, rs587777249, rs767611891, rs2091986259, rs2091987023, rs2091988799
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Mental retardation	Mild Mental Retardation	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)
Mitral valve prolapse	Mitral Valve Prolapse Syndrome	rs768737101
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	26974007
Thauvin-robinet-faivre syndrome	THAUVIN-ROBINET-FAIVRE SYNDROME, Tall stature-intellectual disability-renal anomalies syndrome	rs786204849, rs886037928	26660953, 27183861

Show/Hide Unknown Diseases (5)

Disease term	Disease name	References	Source
Unknown
Crohn disease	Crohn Disease	26192919, 26974007	ClinVar
Thauvin-Robinet-Faivre Syndrome	tall stature-intellectual disability-renal anomalies syndrome		GenCC
Inflammatory Bowel Disease	Inflammatory Bowel Disease		GWAS
Crohn Disease	Crohn Disease		GWAS
Alzheimer disease	Alzheimer disease		GWAS

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	37564211
Alzheimer Disease	Associate	35931864
Aortic Aneurysm Abdominal	Associate	27157464
Breast Neoplasms	Associate	25096995
Lung Neoplasms	Associate	37564211

FIBP (FGF1 intracellular binding protein)