Gene Gene information from NCBI Gene database.
Entrez ID 91543
Gene name Radical S-adenosyl methionine domain containing 2
Gene symbol RSAD2
Synonyms (NCBI Gene)
SANDcig33cig5vig1
Chromosome 2
Chromosome location 2p25.2
Summary The protein encoded by this gene is an interferon-inducible antiviral protein that belongs to the S-adenosyl-L-methionine (SAM) superfamily of enzymes. The protein plays a role in cellular antiviral response and innate immune signaling. Antiviral effects
miRNA miRNA information provided by mirtarbase database.
759
miRTarBase ID miRNA Experiments Reference
MIRT021222 hsa-miR-146a-5p Microarray 18057241
MIRT028788 hsa-miR-26b-5p Microarray 19088304
MIRT1320867 hsa-miR-106a CLIP-seq
MIRT1320868 hsa-miR-106b CLIP-seq
MIRT1320869 hsa-miR-1185 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
47
GO ID Ontology Definition Evidence Reference
GO:0001650 Component Fibrillar center IDA
GO:0002376 Process Immune system process IEA
GO:0003824 Function Catalytic activity IEA
GO:0005515 Function Protein binding IPI 21527675, 21957124, 22045669, 24245804, 32296183
GO:0005739 Component Mitochondrion IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607810 30908 ENSG00000134321
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WXG1
Protein name S-adenosylmethionine-dependent nucleotide dehydratase RSAD2 (SAND) (EC 4.2.-.-) (Cytomegalovirus-induced gene 5 protein) (Radical S-adenosyl methionine domain-containing protein 2) (Virus inhibitory protein, endoplasmic reticulum-associated, interferon-in
Protein function Interferon-inducible antiviral protein which plays a major role in the cell antiviral state induced by type I and type II interferon (PubMed:31812350). Catalyzes the conversion of cytidine triphosphate (CTP) to 3'-deoxy-3',4'-didehydro-CTP (ddhC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13353 Fer4_12 72 199 Domain
PF04055 Radical_SAM 77 266 Radical SAM superfamily Domain
Sequence
MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETK
EEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKI
NFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISC
DSFDEEVNVLIGRGQGKKN
HVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKAL
NPVRWKVFQCLLIEGENCGEDALREA
ERFVIGDEEFERFLERHKEVSCLVPESNQKMKDS
YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLD
W
Sequence length 361
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Hepatitis C
Influenza A
  Interferon alpha/beta signaling