Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	9149
Gene name	Dual specificity tyrosine phosphorylation regulated kinase 1B
Gene symbol	DYRK1B
Synonyms (NCBI Gene)	AOMS3MIRK
Chromosome	19
Chromosome location	19q13.2
Summary	This gene encodes a member of a family of nuclear-localized protein kinases. The encoded protein participates in the regulation of the cell cycle. Expression of this gene may be altered in tumor cells, and mutations in this gene were found to cause abdomi

Show/Hide all (96)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016969	hsa-miR-335-5p	Microarray	18185580
MIRT045408	hsa-miR-149-5p	CLASH	23622248
MIRT044780	hsa-miR-320a	CLASH	23622248
MIRT043128	hsa-miR-324-5p	CLASH	23622248
MIRT038537	hsa-miR-30c-1-3p	CLASH	23622248
MIRT037892	hsa-miR-455-3p	CLASH	23622248
MIRT036171	hsa-miR-320c	CLASH	23622248
MIRT497055	hsa-miR-491-5p	PAR-CLIP	22291592
MIRT497054	hsa-miR-548as-3p	PAR-CLIP	22291592
MIRT497053	hsa-miR-1296-3p	PAR-CLIP	22291592
MIRT497052	hsa-miR-4419a	PAR-CLIP	22291592
MIRT497051	hsa-miR-4510	PAR-CLIP	22291592
MIRT497050	hsa-miR-6127	PAR-CLIP	22291592
MIRT497049	hsa-miR-6129	PAR-CLIP	22291592
MIRT497048	hsa-miR-6130	PAR-CLIP	22291592
MIRT497047	hsa-miR-6133	PAR-CLIP	22291592
MIRT497046	hsa-miR-1249-5p	PAR-CLIP	22291592
MIRT497045	hsa-miR-6797-5p	PAR-CLIP	22291592
MIRT497044	hsa-miR-3926	PAR-CLIP	22291592
MIRT497043	hsa-miR-6090	PAR-CLIP	22291592
MIRT497042	hsa-miR-149-3p	PAR-CLIP	22291592
MIRT497041	hsa-miR-4728-5p	PAR-CLIP	22291592
MIRT497040	hsa-miR-6785-5p	PAR-CLIP	22291592
MIRT497039	hsa-miR-6883-5p	PAR-CLIP	22291592
MIRT497038	hsa-miR-3175	PAR-CLIP	22291592
MIRT497037	hsa-miR-1343-5p	PAR-CLIP	22291592
MIRT497036	hsa-miR-939-5p	PAR-CLIP	22291592
MIRT497035	hsa-miR-6825-5p	PAR-CLIP	22291592
MIRT497034	hsa-miR-4727-3p	PAR-CLIP	22291592
MIRT497033	hsa-miR-4460	PAR-CLIP	22291592
MIRT497032	hsa-miR-3150a-3p	PAR-CLIP	22291592
MIRT497031	hsa-miR-6763-5p	PAR-CLIP	22291592
MIRT497055	hsa-miR-491-5p	PAR-CLIP	22291592
MIRT497054	hsa-miR-548as-3p	PAR-CLIP	22291592
MIRT497053	hsa-miR-1296-3p	PAR-CLIP	22291592
MIRT497052	hsa-miR-4419a	PAR-CLIP	22291592
MIRT497051	hsa-miR-4510	PAR-CLIP	22291592
MIRT497050	hsa-miR-6127	PAR-CLIP	22291592
MIRT497049	hsa-miR-6129	PAR-CLIP	22291592
MIRT497048	hsa-miR-6130	PAR-CLIP	22291592
MIRT497047	hsa-miR-6133	PAR-CLIP	22291592
MIRT497046	hsa-miR-1249-5p	PAR-CLIP	22291592
MIRT497045	hsa-miR-6797-5p	PAR-CLIP	22291592
MIRT497044	hsa-miR-3926	PAR-CLIP	22291592
MIRT497043	hsa-miR-6090	PAR-CLIP	22291592
MIRT497042	hsa-miR-149-3p	PAR-CLIP	22291592
MIRT497041	hsa-miR-4728-5p	PAR-CLIP	22291592
MIRT497040	hsa-miR-6785-5p	PAR-CLIP	22291592
MIRT497039	hsa-miR-6883-5p	PAR-CLIP	22291592
MIRT497038	hsa-miR-3175	PAR-CLIP	22291592
MIRT497037	hsa-miR-1343-5p	PAR-CLIP	22291592
MIRT497036	hsa-miR-939-5p	PAR-CLIP	22291592
MIRT497035	hsa-miR-6825-5p	PAR-CLIP	22291592
MIRT497034	hsa-miR-4727-3p	PAR-CLIP	22291592
MIRT497033	hsa-miR-4460	PAR-CLIP	22291592
MIRT497032	hsa-miR-3150a-3p	PAR-CLIP	22291592
MIRT497031	hsa-miR-6763-5p	PAR-CLIP	22291592
MIRT949668	hsa-miR-143	CLIP-seq
MIRT949669	hsa-miR-145	CLIP-seq
MIRT949670	hsa-miR-185	CLIP-seq
MIRT949671	hsa-miR-4306	CLIP-seq
MIRT949672	hsa-miR-4428	CLIP-seq
MIRT949673	hsa-miR-4644	CLIP-seq
MIRT949674	hsa-miR-4770	CLIP-seq
MIRT1981337	hsa-miR-1185	CLIP-seq
MIRT1981338	hsa-miR-1275	CLIP-seq
MIRT1981339	hsa-miR-135a	CLIP-seq
MIRT1981340	hsa-miR-135b	CLIP-seq
MIRT949668	hsa-miR-143	CLIP-seq
MIRT949670	hsa-miR-185	CLIP-seq
MIRT1981341	hsa-miR-1913	CLIP-seq
MIRT1981342	hsa-miR-1915	CLIP-seq
MIRT1981343	hsa-miR-2392	CLIP-seq
MIRT1981344	hsa-miR-296-5p	CLIP-seq
MIRT1981345	hsa-miR-3184	CLIP-seq
MIRT1981346	hsa-miR-324-3p	CLIP-seq
MIRT1981347	hsa-miR-3605-5p	CLIP-seq
MIRT1981348	hsa-miR-361-3p	CLIP-seq
MIRT1981349	hsa-miR-3679-5p	CLIP-seq
MIRT1981350	hsa-miR-3918	CLIP-seq
MIRT1981351	hsa-miR-423-5p	CLIP-seq
MIRT1981352	hsa-miR-4300	CLIP-seq
MIRT949671	hsa-miR-4306	CLIP-seq
MIRT949672	hsa-miR-4428	CLIP-seq
MIRT1981353	hsa-miR-4525	CLIP-seq
MIRT949673	hsa-miR-4644	CLIP-seq
MIRT1981354	hsa-miR-4650-5p	CLIP-seq
MIRT1981355	hsa-miR-4665-5p	CLIP-seq
MIRT1981356	hsa-miR-4667-3p	CLIP-seq
MIRT1981357	hsa-miR-4685-5p	CLIP-seq
MIRT1981358	hsa-miR-4723-5p	CLIP-seq
MIRT949674	hsa-miR-4770	CLIP-seq
MIRT1981359	hsa-miR-625	CLIP-seq
MIRT1981360	hsa-miR-920	CLIP-seq
MIRT1981341	hsa-miR-1913	CLIP-seq
MIRT1981346	hsa-miR-324-3p	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	11980910
GO:0004672	Function	Protein kinase activity	IDA	11980910
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	9918863
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	11980910, 14500717, 14593110, 20940704, 22939624, 23602568, 27705803, 32296183, 32707033, 33961781, 35016035, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9918863
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006468	Process	Protein phosphorylation	IDA	11980910
GO:0006468	Process	Protein phosphorylation	TAS	9918863
GO:0006974	Process	DNA damage response	IEA
GO:0007520	Process	Myoblast fusion	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IBA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	11980910
GO:0060612	Process	Adipose tissue development	IMP	24827035
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
604556	3092	ENSG00000105204

Q9Y463

Protein name

Dual specificity tyrosine-phosphorylation-regulated kinase 1B (EC 2.7.12.1) (Minibrain-related kinase) (Mirk protein kinase)

Protein function

Dual-specificity kinase which possesses both serine/threonine and tyrosine kinase activities. Plays an essential role in ribosomal DNA (rDNA) double-strand break repair and rDNA copy number maintenance (PubMed:33469661). During DNA damage, media

PDB

8C2Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	111 → 431	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest expression in skeletal muscle, testis, heart and brain with little expression in colon or lung. Expressed in a variety of tumor cell lines. {ECO:0000269|PubMed:10910078}.

Sequence

MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDN
RTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGA
QLPPQPRYLGRPPSPTSPPPPELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGR
PPLPPPDDPATLGPHLGLRGVPQSTAASS

Sequence length

629

Interactions

View interactions

134

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abdominal obesity-metabolic syndrome 3	Pathogenic	rs367643250, rs587777380	RCV000119261 RCV000119262

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Abnormality of neuronal migration	Conflicting classifications of pathogenicity	rs556237495	RCV000201390
DYRK1B-related disorder	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	rs893357514, rs146996483, rs144803038, rs1320191888, rs201029953, rs1010396277, rs563238934, rs529074049, rs147484701, rs775501167, rs373037030, rs377036516, rs776537297, rs572640359, rs966556487 View all (99 more)	RCV004746436 RCV003913416 RCV003911040 RCV004746529 RCV004746581 RCV004746533 RCV003933794 RCV003903708 RCV003936520 RCV003395600 RCV003898868 RCV003953955 RCV003926413 RCV004747106 RCV003961113 RCV004747136 RCV003401044 RCV003936365 RCV003898653 RCV004747234 RCV004747238 RCV004747244 RCV004725600 RCV003420538 RCV004725661 RCV004747283 RCV004747285 RCV004747288 RCV003404305 RCV003417047 RCV003417066 RCV003427846 RCV003417094 RCV003417095 RCV003417118 RCV003410751 RCV003393089 RCV003402869 RCV003410616 RCV003414342 RCV003399947 RCV003397606 RCV003400027 RCV003414181 RCV003412200 RCV003416971 RCV003418774 RCV003402901 RCV003919240 RCV003939065 RCV003939066 RCV004747305 RCV003984383 RCV004747324 RCV003981083 RCV003919343 RCV003893428 RCV004747386 RCV004747399 RCV003896872 RCV003897085 RCV003894592 RCV003909462 RCV003921565 RCV003921622 RCV003929572 RCV003982791 RCV003982804 RCV003893953 RCV003893972 RCV003894015 RCV003894031 RCV003894147 RCV003894242 RCV003894435 RCV003906952 RCV003901997 RCV003912050 RCV003982325 RCV003899374 RCV003911471 RCV003909696 RCV003913976 RCV003943940 RCV003971914 RCV003919473 RCV003941561 RCV003939562 RCV003939663 RCV003939707 RCV003914463 RCV003951423 RCV003922238 RCV003932034 RCV003956790 RCV003964697 RCV003983713 RCV003971740 RCV003969808 RCV003962306 RCV003961881 RCV003964239 RCV004747413 RCV004747438 RCV003935284 RCV003979889 RCV003935815 RCV003983807 RCV003930509 RCV003922953 RCV003932852 RCV004746137 RCV003903050 RCV003983271 RCV004746170
Myoepithelial tumor	Uncertain significance	rs2514841029	RCV002463902

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	25264830
Colonic Neoplasms	Associate	19542220
Colorectal Neoplasms	Associate	19542220, 38040123
Coronary Artery Disease	Associate	24827035
Diabetes Mellitus	Associate	24827035, 37301518
Diabetes Mellitus Type 2	Associate	34193236
Down Syndrome	Associate	25264830
Genetic Diseases Inborn	Associate	25264830
Hypertension	Associate	24827035
Hypoxia	Stimulate	38040123
Infections	Associate	25648438
Lymphoma	Associate	25648438
Metabolic Syndrome	Associate	24827035, 26346493, 28743892
Mouth Diseases	Associate	29559974
Neoplasms	Associate	19542220, 21878655, 22385282, 23114871, 26346493, 38040123
Neurodegenerative Diseases	Associate	25264830
Obesity	Associate	37329217
Osteosarcoma	Associate	20042639
Ovarian Neoplasms	Associate	23114871, 24590896
Pancreatic Neoplasms	Associate	19351855, 21878655, 24590896
Papillomavirus Infections	Associate	26307683
Prostatic Neoplasms	Associate	25777618
Tauopathies	Associate	25264830
Vascular Diseases	Associate	37301518

DYRK1B (dual specificity tyrosine phosphorylation regulated kinase 1B)