DYRK1B (dual specificity tyrosine phosphorylation regulated kinase 1B)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9149
Gene name Gene Name - the full gene name approved by the HGNC.
Dual specificity tyrosine phosphorylation regulated kinase 1B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DYRK1B
Synonyms (NCBI Gene) Gene synonyms aliases
AOMS3, MIRK
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a family of nuclear-localized protein kinases. The encoded protein participates in the regulation of the cell cycle. Expression of this gene may be altered in tumor cells, and mutations in this gene were found to cause abdomi
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(96)
miRTarBase ID miRNA Experiments Reference
MIRT016969 hsa-miR-335-5p Microarray 18185580
MIRT045408 hsa-miR-149-5p CLASH 23622248
MIRT044780 hsa-miR-320a CLASH 23622248
MIRT043128 hsa-miR-324-5p CLASH 23622248
MIRT038537 hsa-miR-30c-1-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(30)
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003713 Function Transcription coactivator activity IBA
GO:0003713 Function Transcription coactivator activity IDA 11980910
GO:0004672 Function Protein kinase activity IDA 11980910
GO:0004672 Function Protein kinase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
604556 3092 ENSG00000105204
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9Y463
Protein name Dual specificity tyrosine-phosphorylation-regulated kinase 1B (EC 2.7.12.1) (Minibrain-related kinase) (Mirk protein kinase)
Protein function Dual-specificity kinase which possesses both serine/threonine and tyrosine kinase activities. Plays an essential role in ribosomal DNA (rDNA) double-strand break repair and rDNA copy number maintenance (PubMed:33469661). During DNA damage, media
PDB 8C2Z
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 111 → 431 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Highest expression in skeletal muscle, testis, heart and brain with little expression in colon or lung. Expressed in a variety of tumor cell lines. {ECO:0000269|PubMed:10910078}.
Sequence 
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDN
RTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGA
QLPPQPRYLGRPPSPTSPPPPELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGR
PPLPPPDDPATLGPHLGLRGVPQSTAASS
Sequence length 629
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Metabolic syndrome abdominal obesity-metabolic syndrome 3 rs367643250, rs587777380 N/A
Show/Hide Text Mining Associations (24)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 25264830
Colonic Neoplasms Associate 19542220
Colorectal Neoplasms Associate 19542220, 38040123
Coronary Artery Disease Associate 24827035
Diabetes Mellitus Associate 24827035, 37301518
Diabetes Mellitus Type 2 Associate 34193236
Down Syndrome Associate 25264830
Genetic Diseases Inborn Associate 25264830
Hypertension Associate 24827035
Hypoxia Stimulate 38040123