NEURL1 (neuralized E3 ubiquitin protein ligase 1)

Gene

• Entrez ID: 9148
• Gene name: Neuralized E3 ubiquitin protein ligase 1
• Gene symbol: NEURL1
• Synonyms (NCBI Gene): NEUR1, NEURL, RNF67, bA416N2.1, neu, neu-1
• Chromosome: 10
• Chromosome location: 10q24.33

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT528646	hsa-miR-4690-3p	PAR-CLIP	22012620
MIRT528644	hsa-miR-5685	PAR-CLIP	22012620
MIRT528643	hsa-miR-5088-3p	PAR-CLIP	22012620
MIRT528642	hsa-miR-4713-5p	PAR-CLIP	22012620
MIRT528641	hsa-miR-629-3p	PAR-CLIP	22012620
MIRT754503	hsa-miR-4690-3p	PAR-CLIP	22012620
MIRT754504	hsa-miR-5685	PAR-CLIP	22012620
MIRT754505	hsa-miR-5088-3p	PAR-CLIP	22012620
MIRT754506	hsa-miR-4713-5p	PAR-CLIP	22012620
MIRT754507	hsa-miR-629-3p	PAR-CLIP	22012620

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	ISS
GO:0005515	Function	Protein binding	IPI	36931259
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	20847082
GO:0005886	Component	Plasma membrane	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0006513	Process	Protein monoubiquitination	IEA
GO:0006513	Process	Protein monoubiquitination	ISS
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007288	Process	Sperm axoneme assembly	IEA
GO:0007399	Process	Nervous system development	TAS	9519875
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0007595	Process	Lactation	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	20847082
GO:0010646	Process	Regulation of cell communication	IEA
GO:0014069	Component	Postsynaptic density	IBA
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0023051	Process	Regulation of signaling	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030425	Component	Dendrite	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	20847082
GO:0043197	Component	Dendritic spine	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0043204	Component	Perikaryon	IEA
GO:0043204	Component	Perikaryon	ISS
GO:0045182	Function	Translation regulator activity	IEA
GO:0045182	Function	Translation regulator activity	ISS
GO:0045202	Component	Synapse	IEA
GO:0045746	Process	Negative regulation of Notch signaling pathway	IBA
GO:0045746	Process	Negative regulation of Notch signaling pathway	IDA	20847082
GO:0046872	Function	Metal ion binding	IEA
GO:0048170	Process	Positive regulation of long-term neuronal synaptic plasticity	IEA
GO:0048170	Process	Positive regulation of long-term neuronal synaptic plasticity	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051491	Process	Positive regulation of filopodium assembly	IEA
GO:0051491	Process	Positive regulation of filopodium assembly	ISS
GO:0060999	Process	Positive regulation of dendritic spine development	IEA
GO:0060999	Process	Positive regulation of dendritic spine development	ISS
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	ISS
GO:0090129	Process	Positive regulation of synapse maturation	IEA
GO:0090129	Process	Positive regulation of synapse maturation	ISS
GO:0097440	Component	Apical dendrite	IEA
GO:0097440	Component	Apical dendrite	ISS
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150052	Process	Regulation of postsynapse assembly	IEA

Other IDs

• MIM: 603804
• HGNC: 7761
• e!Ensembl: ENSG00000107954

Protein

• UniProt ID: O76050
• Protein name: E3 ubiquitin-protein ligase NEURL1 (EC 2.3.2.27) (Neuralized-like protein 1A) (h-neu) (h-neuralized 1) (RING finger protein 67) (RING-type E3 ubiquitin transferase NEURL1)
• Protein function: Plays a role in hippocampal-dependent synaptic plasticity, learning and memory. Involved in the formation of spines and functional synaptic contacts by modulating the translational activity of the cytoplasmic polyadenylation element-binding prot
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07177	Neuralized	65 → 217	Neuralized	Domain
  PF07177	Neuralized	296 → 447	Neuralized	Domain
  PF13920	zf-C3HC4_3	518 → 567		Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, testis, pituitary gland, pancreas and bone marrow. Also poorly expressed in malignant astrocytomas and several neuroectodermal tumor cell lines. Weakly expressed in medulloblastoma (MB) compared with normal cerebell
• Sequence:

  MGNNFSSIPSLPRGNPSRAPRGHPQNLKDSIGGPFPVTSHRCHHKQKHCPAVLPSGGLPA
  TPLLFHPHTKGSQILMDLSHKAVKRQASFCNAITFSNRPVLIYEQVRLKITKKQCCWSGA
  LRLGFTSKDPSRIHPDSLPKYACPDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFH
  RINDSAVMLFFSGVRTADPLWALVDVYGLTRGVQLLDSELVLPDCLRPRSFTALRRPSLR
  READDARLSVSLCDLNVPGADGDEAAPAAGCPIPQNSLNSQHSRALPAQLDGDLRFHALR
  AGAHVRILDEQTVARVEHGRDERALVFTSRPVRVAETIFVKVTRSGGARPGALSFGVTTC
  DPGTLRPADLPFSPEALVDRKEFWAVCRVPGPLHSGDILGLVVNADGELHLSHNGAAAGM
  QLCVDASQPLWMLFGLHGTITQIRILGSTILAERGIPSLPCSPASTPTSPSALGSRLSDP
  LLSTCSSGPLGSSAGGTAPNSPVSLPESPVTPGLGQWSDECTICYEHAVDTVIYTCGHMC
  LCYACGLRLKKALHACCPICRRPIKDIIKTYRSS

• Sequence length: 574

Pathways

Reactome:

Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants