Gene Gene information from NCBI Gene database.
Entrez ID 9146
Gene name Hepatocyte growth factor-regulated tyrosine kinase substrate
Gene symbol HGS
Synonyms (NCBI Gene)
HRS
Chromosome 17
Chromosome location 17q25.3
Summary The protein encoded by this gene regulates endosomal sorting and plays a critical role in the recycling and degradation of membrane receptors. The encoded protein sorts monoubiquitinated membrane proteins into the multivesicular body, targeting these prot
miRNA miRNA information provided by mirtarbase database.
176
miRTarBase ID miRNA Experiments Reference
MIRT004900 hsa-miR-296-5p Luciferase reporter assayWestern blot 18977327
MIRT004900 hsa-miR-296-5p Luciferase reporter assayWestern blot 18977327
MIRT004900 hsa-miR-296-5p Luciferase reporter assayWestern blot 18977327
MIRT004900 hsa-miR-296-5p Luciferase reporter assayWestern blot 18977327
MIRT052221 hsa-let-7b-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
48
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 10861283, 11779178, 12802020, 15611048, 16084064, 16189514, 17853893, 18675823, 19278655, 20150893, 21070952, 22046132, 22458338, 24790097, 25416956, 25588945, 25910212, 26871637, 29892012, 29997244, 31467278, 31515488, 32296183, 32814053, 33961781, 35271311, 37398436
GO:0005737 Component Cytoplasm IEA
GO:0005764 Component Lysosome IDA
GO:0005768 Component Endosome IDA 15611048
GO:0005768 Component Endosome IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604375 4897 ENSG00000185359
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14964
Protein name Hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) (Protein pp110)
Protein function Involved in intracellular signal transduction mediated by cytokines and growth factors. When associated with STAM, it suppresses DNA signaling upon stimulation by IL-2 and GM-CSF. Could be a direct effector of PI3-kinase in vesicular pathway via
PDB 2D3G , 3F1I , 3OBQ , 3ZYQ , 4AVX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00790 VHS 3 139 VHS domain Domain
PF01363 FYVE 158 221 FYVE zinc finger Domain
PF12210 Hrs_helical 407 501 Hepatocyte growth factor-regulated tyrosine kinase substrate Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous expression in adult and fetal tissues with higher expression in testis and peripheral blood leukocytes. {ECO:0000269|PubMed:9407053, ECO:0000269|PubMed:9630564}.
Sequence
MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHV
ALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFR
NEPKYKVVQDTYQIMKVEG
HVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKH
HCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNR
KAEGKATSTTELPPEYLTS
PLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERLRQKSTYTSYPKAEPMPSASS
APPASSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQ
PGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFV
NRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDA
RGALSALREEHREKLRRAAEE
AERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQE
KERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVE
GSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAY
SSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPS
QDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD
Sequence length 777
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Viral life cycle - HIV-1
Endocytosis
Phagosome
  EGFR downregulation
Lysosome Vesicle Biogenesis
Ub-specific processing proteases
Negative regulation of MET activity
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Endosomal Sorting Complex Required For Transport (ESCRT)
Inhibition of membrane repair
Prevention of phagosomal-lysosomal fusion
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
6
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Clear cell carcinoma of kidney Benign rs34340361 RCV005911806
Colon adenocarcinoma Benign rs34340361 RCV005911804
Gastric cancer Benign rs34340361 RCV005911807
Lung cancer Benign rs34340361 RCV005911809
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 29891722, 38608999
Carcinoma Hepatocellular Associate 26715116, 29042578
Colorectal Neoplasms Associate 27312428
Lung Neoplasms Associate 40311306
Lymphoma Associate 16098063
Macular Degeneration Associate 24439028
Multiple Myeloma Associate 16638930
Neoplasms Associate 16098063, 31744816