Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
91445
Gene name Gene Name - the full gene name approved by the HGNC.
Ring finger protein 185
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RNF185
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q12.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT042563 hsa-miR-423-3p CLASH 23622248
MIRT040228 hsa-miR-615-3p CLASH 23622248
MIRT499677 hsa-miR-551b-5p PAR-CLIP 24398324
MIRT205530 hsa-miR-3125 PAR-CLIP 24398324
MIRT205532 hsa-miR-3916 PAR-CLIP 24398324
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0004842 Function Ubiquitin-protein transferase activity IEA
GO:0005515 Function Protein binding IPI 19549727, 21931693, 24019521, 25416956, 28514442, 31515488, 32296183, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
620096 26783 ENSG00000138942
Protein
UniProt ID Q96GF1
Protein name E3 ubiquitin-protein ligase RNF185 (EC 2.3.2.27) (RING finger protein 185)
Protein function E3 ubiquitin-protein ligase that regulates selective mitochondrial autophagy by mediating 'Lys-63'-linked polyubiquitination of BNIP1 (PubMed:21931693). Acts in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway, which targets
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13920 zf-C3HC4_3 35 85 Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:27485036}.
Sequence
MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCW
PCLHQWLETRPNRQVCPVCKAGISR
DKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENR
GGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLF
VALVIMFWLLIA
Sequence length 192
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Protein processing in endoplasmic reticulum   ABC-family proteins mediated transport
Defective CFTR causes cystic fibrosis
ER Quality Control Compartment (ERQC)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 35183197 CBGDA
Tremor Essential tremor N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Glioblastoma Associate 35183197
Glioma Inhibit 35183197
Lupus Erythematosus Systemic Stimulate 28273161
Neoplasms Inhibit 35183197