PDCD5 (programmed cell death 5)

Gene

• Entrez ID: 9141
• Gene name: Programmed cell death 5
• Gene symbol: PDCD5
• Synonyms (NCBI Gene): TFAR19
• Chromosome: 19
• Chromosome location: 19q13.11
• Summary: This gene encodes a protein that is upregulated during apoptosis where it translocates rapidly from the cytoplasm to the nucleus. The encoded protein may be an important regulator of K(lysine) acetyltransferase 5 (a protein involved in transcription, DNA

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT044914	hsa-miR-186-5p	CLASH	23622248
MIRT044914	hsa-miR-186-5p	CLASH	23622248
MIRT039944	hsa-miR-615-3p	CLASH	23622248
MIRT1219446	hsa-miR-1468	CLIP-seq
MIRT1219447	hsa-miR-3168	CLIP-seq
MIRT1219448	hsa-miR-3182	CLIP-seq
MIRT1219449	hsa-miR-3663-3p	CLIP-seq
MIRT1219450	hsa-miR-4677-3p	CLIP-seq
MIRT1219451	hsa-miR-4679	CLIP-seq
MIRT1219452	hsa-miR-554	CLIP-seq
MIRT1219453	hsa-miR-676	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
KLF9	Activation	24173774

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	24012345, 24375412, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	24012345
GO:0005737	Component	Cytoplasm	HDA	16791210
GO:0005829	Component	Cytosol	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0008201	Function	Heparin binding	IDA	17165023
GO:0010628	Process	Positive regulation of gene expression	IDA	24012345
GO:0010698	Function	Acetyltransferase activator activity	IDA	24012345
GO:0042981	Process	Regulation of apoptotic process	IMP	16374546
GO:0043065	Process	Positive regulation of apoptotic process	IMP	9920759
GO:0048487	Function	Beta-tubulin binding	IPI	24375412
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IDA	24012345
GO:1903333	Process	Negative regulation of protein folding	IMP	24375412

Other IDs

• MIM: 604583
• HGNC: 8764
• e!Ensembl: ENSG00000105185

Protein

• UniProt ID: O14737
• Protein name: Programmed cell death protein 5 (TF-1 cell apoptosis-related protein 19) (Protein TFAR19)
• Protein function: May function in the process of apoptosis.
• PDB: 1YYB, 2CRU, 2K6B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01984	dsDNA_bind	9 → 114	Double-stranded DNA-binding domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Highest levels in heart, testis, kidney, pituitary gland, adrenal gland and placenta.
• Sequence:

  MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLA
  LVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSD
  EDDDY

• Sequence length: 125

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBERCULOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Arthritis	Associate	31282065	★☆☆☆☆ Found in Text Mining only
Bohring syndrome	Associate	15020679	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	28051100	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	32248621	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Associate	15132838	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Associate	27255549	★☆☆☆☆ Found in Text Mining only
Death	Associate	15020679	★☆☆☆☆ Found in Text Mining only
Glioma	Inhibit	22688731	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Associate	29527211	★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	17374122	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	28051100	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	19383853	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	26617773	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	29527211	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	33215428	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Associate	33215428	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	27255549	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	22688731, 39567206	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	24265335, 27255549	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	15132838, 23322062, 31282065	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Inhibit	25881604	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Inhibit	24265335	★☆☆☆☆ Found in Text Mining only